DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chm and kat7a

DIOPT Version :9

Sequence 1:NP_001260192.1 Gene:chm / 43928 FlyBaseID:FBgn0028387 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_001070052.1 Gene:kat7a / 767644 ZFINID:ZDB-GENE-060929-168 Length:128 Species:Danio rerio


Alignment Length:152 Identity:34/152 - (22%)
Similarity:60/152 - (39%) Gaps:46/152 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 LPPAKKNGGGPVISSDGSSGSESGSNSGDESSSGSESEGSDSSNSYSSQPVKGGAKGKRSGPTKI 276
            :|..|:|.|.   ||:|:..|:..:    |.:..||||.....|:             |...:.:
Zfish     1 MPRRKRNAGS---SSEGTEDSDFSA----EHTDSSESEAHVVRNT-------------RLTRSSL 45

  Fly   277 QNSDSEEERKDKANP------------MRKLTRSLSMRRT---KQQPKQE-----TDSESDGDLE 321
            :.|.|.::.....||            .|::|||.....|   |:.|.::     :|:|..|::.
Zfish    46 RLSRSSQDASPVRNPTAPVSEEVVNYSTRRVTRSQQQGATVSPKKYPLRQSRSSGSDTEQHGEIS 110

  Fly   322 DDKIMISKSPAKKPAPSNLNAS 343
            :      :...:||..|:|..|
Zfish   111 E------RGRRRKPHGSSLMPS 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chmNP_001260192.1 zf-C2HC 376..402 CDD:279824
NAT_SF 526..802 CDD:302625
MOZ_SAS 584..766 CDD:280097
kat7aNP_001070052.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 275 1.000 Domainoid score I1718
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 478 1.000 Inparanoid score I1438
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004861
OrthoInspector 1 1.000 - - otm25153
orthoMCL 1 0.900 - - OOG6_103737
Panther 1 1.100 - - O PTHR10615
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2913
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.