DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chm and CG1894

DIOPT Version :9

Sequence 1:NP_001260192.1 Gene:chm / 43928 FlyBaseID:FBgn0028387 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster


Alignment Length:482 Identity:148/482 - (30%)
Similarity:224/482 - (46%) Gaps:93/482 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 NASKSKVKREPIGISSGVLSSIKSRP-VSPITQTEKKCPIEGCDSSGHLSGNLDKHFLPEACPIY 404
            |.|...:|.:|:|...|:.|.:...| ...:|..::.....|                       
  Fly     5 NRSGDHLKYQPLGDQDGISSKLPDIPRALQLTNAKESSATRG----------------------- 46

  Fly   405 HNMSASECKERANERKLRNEQRLKMPVNIVTAPGNQNTNLKTLSPEQREFLAKIRESRANFKPAN 469
              :..|..|....:.:|:|:..|:..:        |.|  ||::.      :.|...|....|  
  Fly    47 --LGQSASKSEMGKSQLQNDSSLQKNI--------QET--KTITG------SCIEAQRIGATP-- 91

  Fly   470 NNFLDSKVKLEKDVTDEDREPNLAGLVPDYDLQLFREAQA-----QASERIEDELKD-------- 521
                  |.:||     ..:|||:..|       |...|.:     |..|.|::|..|        
  Fly    92 ------KKQLE-----GVKEPNMISL-------LHTNASSNVDDRQRQETIDNEKSDVQKEKEDA 138

  Fly   522 -LPVGKGIKYISMGKYKMKVWYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRHAEKCVWRHPP 585
             :.|.:.|:.:..|:|:::....||||....:...:|:|||||:|.........|...|..|.||
  Fly   139 KVKVIRNIEKVQFGRYEIETTSSSPYPVINDKATTIYVCEFCLKYMCLRKSYSYHLYDCKKRCPP 203

  Fly   586 GDEIYRKGKLQVWQVDGKRYKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYIMTLADVDGCHIVGY 650
            |..:|||..:.:::|||.:.:.|||.|||::|.||::|.:.|....|||||:.|.|.||.|..||
  Fly   204 GSLLYRKDNIYIYEVDGHKEQLYCQCLCLMSKLFLENKKILYSSSSFLFYILCLKDKDGEHFAGY 268

  Fly   651 FSKHIPFLQEKNSFYNVSCILTLPPYQRKGYGRLLIDFSYLLTRVEGKIGSPEKPLSDLGLISYR 715
            |::....|.     .|::|||.||||.|||||:||||.||.::|.|..||.|:||||.:..:.|.
  Fly   269 FAREKTMLN-----INLNCILVLPPYMRKGYGKLLIDLSYEISRREACIGGPKKPLSKVARLCYL 328

  Fly   716 SYWKDVLLDYLCNRSG-NTIAIKDVSQETAIYSYDIVSTLQALGMMKYWKGKHIVLKKQDVLDEY 779
            |||..:||:.|.:.|. :.:.|:::|:.|.....||:|||:.:||.||:|..||:......:.| 
  Fly   329 SYWGHILLNLLRHHSSPDLVTIEELSKATGFREEDIISTLEFMGMTKYYKVDHIMFYTTSSIIE- 392

  Fly   780 EERVKRRG--TFPK----IDDSCLRWQ 800
                .|||  .|.|    |..:.|.|:
  Fly   393 ----DRRGLAQFKKPRLTIHRNRLSWK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chmNP_001260192.1 zf-C2HC 376..402 CDD:279824 1/25 (4%)
NAT_SF 526..802 CDD:302625 111/282 (39%)
MOZ_SAS 584..766 CDD:280097 83/182 (46%)
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 105/274 (38%)
MOZ_SAS 202..378 CDD:280097 82/180 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463872
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10615
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.