DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chm and d4

DIOPT Version :9

Sequence 1:NP_001260192.1 Gene:chm / 43928 FlyBaseID:FBgn0028387 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_610163.1 Gene:d4 / 35485 FlyBaseID:FBgn0033015 Length:497 Species:Drosophila melanogaster


Alignment Length:368 Identity:75/368 - (20%)
Similarity:120/368 - (32%) Gaps:108/368 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PSNPANKPSNPTQRSANNNTNRSLENGEGKRPSLSSSSNST-DDSMKIVKNGRKVPLKMASTVRP 205
            ||:...||    :|....|.|:|....:.:..:|..|.:.| .....|..:|..||         
  Fly    89 PSSRWRKP----KRQYLLNPNQSFRAYQYREHNLQHSHHQTHQHHHHIPSSGVAVP--------- 140

  Fly   206 KQIRGKLPPAKKNGGGPVISSDGSSGSESGSNSGDESSSGSESE-------------------GS 251
                 :.|...::..  :.::||:|...||.|...:|.:..|.|                   ..
  Fly   141 -----QNPHLAESAA--IAATDGNSMGASGDNDSKDSHANVEKEWFHDEMDTSHFHHGDEFEDDF 198

  Fly   252 DSSNSYSSQPVKGGAKGKRSGPTKIQ-NSDSEEERKDKANPMRKLTRSLSMRRTKQQPKQETDSE 315
            ||.|.:.......|.:.|.|.|.:.. |.:...:|..|....|:              |...:.|
  Fly   199 DSDNDFDESYTSRGKRKKCSRPRRTNANVEGTPKRGRKGGGNRR--------------KNAVEGE 249

  Fly   316 SDGDLEDDKIMISKSPAKKPAPSNLNASKSKVKREPIGISSGVLSSIKSRPVSPITQTEKKCPIE 380
            ||..........:.|.|...|.    |:.:........::|..|.:..|...|||       ||.
  Fly   250 SDRKRRAGGNSANTSAAAAAAA----AAVAHAACTAAAVASTGLYASHSNSASPI-------PIN 303

  Fly   381 GCDS-SG-----HLSGNLDK---------HFLPEACPIYHN---MSASECKER------------ 415
            ..:| ||     ::|.:.||         ..:|.|..:..|   .:::.|...            
  Fly   304 DDNSQSGLILPTNISSSYDKTSSDAGASNDSIPLATMVAINAGLTTSNVCNAHPVQTGTNQTVFA 368

  Fly   416 -ANERKLRNEQRLKMPVNIVTAP------GNQNTNLKTLSPEQ 451
             .|:.|.|.|:.:..|     :|      |:|..|.||..||:
  Fly   369 TGNKVKQRVERDIAQP-----SPYCDFCLGDQRENKKTNMPEE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chmNP_001260192.1 zf-C2HC 376..402 CDD:279824 10/40 (25%)
NAT_SF 526..802 CDD:302625
MOZ_SAS 584..766 CDD:280097
d4NP_610163.1 Requiem_N 30..98 CDD:290758 4/12 (33%)
PHD1_d4 387..442 CDD:277091 7/20 (35%)
PHD2_d4 444..489 CDD:277005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.