DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chm and tth

DIOPT Version :9

Sequence 1:NP_001260192.1 Gene:chm / 43928 FlyBaseID:FBgn0028387 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster


Alignment Length:366 Identity:73/366 - (19%)
Similarity:118/366 - (32%) Gaps:138/366 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GSSSSESGSSST-------------SGSTSSET-----GSSSDTDSSSATPEEKPSTNSSAKSQT 52
            ||:|..|.||.|             .||..|:|     |:.|..:|||.......:::|....|.
  Fly   140 GSNSLASSSSLTLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGAAGGDTSDSKDSQQQ 204

  Fly    53 QTQQQTNSGNAQRRKPVP------------AASEDKPKPSVAPSSKKVNNPPKSKLSSDDDEYED 105
            |.||..:...|.:.:.:|            ..|.::||                  |..|||| |
  Fly   205 QHQQHQHQQQAVKEELLPKEWFYDDMDMNDVDSLEEPK------------------SPADDEY-D 250

  Fly   106 SAP-----------PAKKNSRAMGSSTVTAA------AAASAARRKPPASVNKPSNPANKPSNPT 153
            ..|           |.|:...:.|......|      ..:|::||:..|:               
  Fly   251 YDPRYGNKKRRKRRPGKRGGDSGGGGGGGGAGGGGNSGGSSSSRRRSAAA--------------- 300

  Fly   154 QRSANNNTNRSLENGEGKRPSLSSSSNSTDDSMKIVKNGRKVPLKMASTVRPKQIRGKLPPAKKN 218
                              |..::::..:.|.|::.:::|..||                    .:
  Fly   301 ------------------RSRITTTDAALDASLEAIESGESVP--------------------GS 327

  Fly   219 GGGPVISSDGSSGSESGSNSGDESSSGSESEGSDSSNSYSSQPVKGGAKGKR--SGPTKIQNSDS 281
            .|||:.|....|||.....:|...|.|.......|:||..|:  ..|.:|:|  .||.....:..
  Fly   328 NGGPISSGGILSGSLGAGLAGVSGSGGGGGASGASANSRRSR--GAGTRGRRRAKGPNSAVGASC 390

  Fly   282 EEERKDKANPMRKLTRSLSMRRTKQQPKQETDSESDGDLED 322
                 |..:|...:          :.|..|:.:.:.|.:||
  Fly   391 -----DPTSPGMVI----------EPPSFESAAAAVGVVED 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chmNP_001260192.1 zf-C2HC 376..402 CDD:279824
NAT_SF 526..802 CDD:302625
MOZ_SAS 584..766 CDD:280097
tthNP_001285216.1 Requiem_N 24..94 CDD:290758
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.