DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chm and mst1

DIOPT Version :9

Sequence 1:NP_001260192.1 Gene:chm / 43928 FlyBaseID:FBgn0028387 Length:811 Species:Drosophila melanogaster
Sequence 2:NP_594630.1 Gene:mst1 / 2543506 PomBaseID:SPAC637.12c Length:463 Species:Schizosaccharomyces pombe


Alignment Length:407 Identity:154/407 - (37%)
Similarity:224/407 - (55%) Gaps:41/407 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 PEACPIYHNMSASECKERANERKLRNEQRLKMPVNIVTAPGNQNTNLKTLSPEQREFLAKIRESR 462
            ||.....|....|..:.:|.:|:           ..:|||  ..|...|.|.|:.|......||.
pombe    83 PEKPKKAHGKGKSSKRPKAVDRR-----------RSITAP--SKTEPSTPSTEKPEPSTPSGESD 134

  Fly   463 ANFKPANNNFLDSKVKLEKDVTDEDREPNLAGLVPDYDLQLFREAQAQASERIEDELKDLPVGKG 527
            ......|.:.         .:.:||.:|.......:.:...|..:..|....|...       :.
pombe   135 HGSNAGNESL---------PLLEEDHKPESLSKEQEVERLRFSGSMVQNPHEIARI-------RN 183

  Fly   528 IKYISMGKYKMKVWYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRHAEKCVWRHPPGDEIYRK 592
            |..|.:|.::::.||.||||.:.:.:..:|||.||..|..||...:||.|||..:||||:||||.
pombe   184 INKICIGDHEIEPWYFSPYPKEFSEVDIVYICSFCFCYYGSERQFQRHREKCTLQHPPGNEIYRD 248

  Fly   593 GKLQVWQVDGKRYKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYIMTLADVDGCHIVGYFSKHIPF 657
            ..:..:::||::.:.:|:::|||:|.|||||.|||||:|||||.|...|..|||:||||||.   
pombe   249 DYISFFEIDGRKQRTWCRNICLLSKLFLDHKMLYYDVDPFLFYCMCRRDEYGCHLVGYFSKE--- 310

  Fly   658 LQEKNSFYNVSCILTLPPYQRKGYGRLLIDFSYLLTRVEGKIGSPEKPLSDLGLISYRSYWKDVL 722
             :|.:..||::||||||.|||.|||:|||.|||.||:.|.|.||||||||||||||||:||.:.:
pombe   311 -KESSENYNLACILTLPQYQRHGYGKLLIQFSYELTKREHKHGSPEKPLSDLGLISYRAYWAEQI 374

  Fly   723 LDYLCNRSGNTIAIKDVSQETAIYSYDIVSTLQALGMMKYWKGKHIVLKKQDVLDEYE--ERVKR 785
            ::.:......| .|.:::.:|::.:.|::.|||||.|:||:||:.|:.....:..:||  :..||
pombe   375 INLVLGMRTET-TIDELANKTSMTTNDVLHTLQALNMLKYYKGQFIICISDGIEQQYERLKNKKR 438

  Fly   786 RGTFPKIDDSCLR-WQP 801
            |    :|:...|. |||
pombe   439 R----RINGDLLADWQP 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chmNP_001260192.1 zf-C2HC 376..402 CDD:279824 2/3 (67%)
NAT_SF 526..802 CDD:302625 131/279 (47%)
MOZ_SAS 584..766 CDD:280097 96/181 (53%)
mst1NP_594630.1 SAS2 16..447 CDD:227360 150/401 (37%)
Tudor-knot 21..74 CDD:288553
NAT_SF 176..451 CDD:302625 130/290 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10615
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.