DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fal and Samhd1

DIOPT Version :9

Sequence 1:NP_001137974.1 Gene:fal / 43927 FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001178672.1 Gene:Samhd1 / 311580 RGDID:1308369 Length:620 Species:Rattus norvegicus


Alignment Length:348 Identity:94/348 - (27%)
Similarity:154/348 - (44%) Gaps:75/348 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLG----LLPWAIDKKADHKRYDHCLGAYKSAQ 62
            :..|.:||.||....:..|::.|.||||:::.|||    :.|     .|.|.|::|.||....|.
  Rat   116 VFNDPIHGHIEFHPLLIRIIDTPQFQRLRYIKQLGGGYYVFP-----GASHNRFEHSLGVGYLAG 175

  Fly    63 DHLRAIERNSHYEPKLPDWCRQ--AVEIAALLHDIGHGPMSHAW----------ELVTHHE---- 111
            ..:||:   :..:|:|....|.  .|:||.|.||:||||.||.:          ::...||    
  Rat   176 CLVRAL---AEKQPELQISERDMLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPDIKWRHEQGSV 237

  Fly   112 --FDH--EENAMACVDKIFKDALNQELVSLRDDGGGRGVQLIKALILGSS----ENLPFPMLGH- 167
              |:|  ..|.:..|.|      |..||...|      :..||..|:|..    ::..:|..|. 
  Rat   238 EMFEHLVNSNELKLVMK------NYGLVPEED------ITFIKEQIMGPPVSPVKDCLWPYKGRP 290

  Fly   168 ---TYIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDVFLQARI-----SPDGQRIEY 224
               :::::||.|:|.|:|||||||..||...|.|.::  .|:......|||     .....::::
  Rat   291 AKKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARICEVDDETRAHKVKH 353

  Fly   225 ---RYADYHRVYRLFEARSLLHVKAYQYPLTCAMDVIFVSVVQRIAPELLSIRSKDPK------- 279
               |..:...:|.:|..|:.||.:|||:.:...:|::......:..|.:....::..|       
  Rat   354 ICTREKEVGNLYDMFHTRNCLHRRAYQHKIGNLIDIMITEAFLKADPHVEITGTEGKKFRISTAI 418

  Fly   280 -----WLELTDEYVLNVI-EKDP 296
                 :.:|||...|.:: ..||
  Rat   419 HDMEAFSKLTDNIFLEILYSTDP 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 57/189 (30%)
Samhd1NP_001178672.1 SAM_HD 40..109 CDD:188907
SAM 43..106 CDD:197735
YdhJ 114..508 CDD:224004 94/348 (27%)
HDc 161..334 CDD:238032 57/189 (30%)
TIM_phosphate_binding <497..>591 CDD:304361
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334495
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426111at33208
OrthoFinder 1 1.000 - - FOG0002596
OrthoInspector 1 1.000 - - oto96821
orthoMCL 1 0.900 - - OOG6_100615
Panther 1 1.100 - - LDO PTHR11373
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1701
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.750

Return to query results.
Submit another query.