DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fal and samhd1

DIOPT Version :9

Sequence 1:NP_001137974.1 Gene:fal / 43927 FlyBaseID:FBgn0028380 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_031750194.1 Gene:samhd1 / 100498574 XenbaseID:XB-GENE-976503 Length:630 Species:Xenopus tropicalis


Alignment Length:357 Identity:99/357 - (27%)
Similarity:162/357 - (45%) Gaps:65/357 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLG----LLPWAIDKKADHKRYDHCLGAYKSAQ 62
            :..|.:||.|||...:..|::.|.||||:::.|||    :.|     .|.|.|::|.:|....|.
 Frog   114 VFNDPIHGHIELHPLLVRIIDTPEFQRLRYIKQLGGSYYVFP-----GASHNRFEHSIGVGYLAG 173

  Fly    63 DHLRAIERNSHYEPKLPDWCRQ--AVEIAALLHDIGHGPMSHAWE------LVTHHEFDHEENAM 119
            ..::|:...   :|:|....|.  .|:||.|.||:||||.||.::      .....:|.||..::
 Frog   174 CLVQALHER---QPELQINHRDMLCVQIAGLCHDLGHGPFSHMFDGRFMPLACPKRKFKHESASV 235

  Fly   120 ACVDKIFK-----DALNQELVSLRDDGGGRGVQLIKALILG-----------SSEN-LPFPMLGH 167
            |..|.:.|     :.:.:..:.|.||     :..||..|.|           ||:| ..:|..|.
 Frog   236 AMFDHLIKSNGLEEVMKEYGLCLPDD-----LTFIKEQIAGPLSSEDEQQFNSSQNSSSWPYRGR 295

  Fly   168 T----YIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDVFLQARISPDGQR--IEYRY 226
            |    ::::||.|:|.|:|||||||..||...|.|.::  .|:......||:...|.:  |..|.
 Frog   296 TEEKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFLKFARVCEVGSKKHICTRD 358

  Fly   227 ADYHRVYRLFEARSLLHVKAYQYPLTCAMDVIFVSVVQRIAPELLSIRSKDPK------------ 279
            .:...:|.:|..|:.||.:|||:.:...::.:......:..|. :.|:..|..            
 Frog   359 KEVGNLYDMFHTRNCLHRRAYQHKVGNIIETMITDAFIKADPH-IRIKGSDGNYYTISGSVDDMV 422

  Fly   280 -WLELTDEYVLNVIEKD-PISRYVKEPHRLVE 309
             :.:|||....:::..| |..:..:|..|.||
 Frog   423 AYTKLTDNIYHHILYSDNPDLKEAREILRKVE 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
falNP_001137974.1 HDc 48..210 CDD:238032 57/190 (30%)
samhd1XP_031750194.1 SAM_HD 40..107 CDD:188907
YdhJ 112..>474 CDD:224004 99/357 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5060
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426111at33208
OrthoFinder 1 1.000 - - FOG0002596
OrthoInspector 1 1.000 - - otm48384
Panther 1 1.100 - - LDO PTHR11373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1701
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.160

Return to query results.
Submit another query.