DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jim and ZNF479

DIOPT Version :9

Sequence 1:NP_001262221.1 Gene:jim / 43924 FlyBaseID:FBgn0027339 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_001357058.1 Gene:ZNF479 / 90827 HGNCID:23258 Length:524 Species:Homo sapiens


Alignment Length:345 Identity:114/345 - (33%)
Similarity:160/345 - (46%) Gaps:50/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 HSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHANEKPFTC 387
            |:..:.:||..|||.|...|....|..|||..:|:.|.||||.|...::||:|.|.|..|||:||
Human   207 HTREKSYKCKECGKSFNCSSNHTTHKIIHTGEKPYRCEECGKAFSWSANLTRHKRTHTGEKPYTC 271

  Fly   388 PYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQDVSPHLIFKNGP---- 448
            ..|.::||:.:.|..|.|||:||:|:.|.||||.|...:.|..|.|.|....|....:.|.    
Human   272 EECGQAFRRSSALTNHKRIHTGERPYKCEECGKAFSVSSTLTDHKRIHTGEKPCRCEECGKAFSW 336

  Fly   449 ------HPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKGQKIL 507
                  |..:...:.|:..|:                                    .|:...:.
Human   337 SSNLTRHKRIHTREKPYACEE------------------------------------CGQAFSLS 365

  Fly   508 PEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL 572
            ..:::|..:.....|  ..|..|.::|::.:.|..|..||...|||.|.||||.|...|.||.|.
Human   366 SNLMRHRRIHTGEKP--YTCEECGQDFRRSSALTIHKRIHTGERPYKCEECGKVFSLSSTLTDHK 428

  Fly   573 RIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPF 637
            ||||.|:|:.|..|.:.|...:.|..|.||||||:||.|.:|||.|...:.|.||.|.|.|::|:
Human   429 RIHTGERPYKCEECGKAFSLSSTLTDHKRIHTGERPYTCEECGKAFNCSSTLMQHKRIHTGEKPY 493

  Fly   638 CCPMPNCRRRFATENEVTKH 657
            .|  ..|.:.|...:.:.||
Human   494 KC--EECEQAFKWHSSLAKH 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jimNP_001262221.1 C2H2 Zn finger 331..351 CDD:275368 7/19 (37%)
COG5048 355..666 CDD:227381 102/313 (33%)
zf-C2H2 357..379 CDD:278523 10/21 (48%)
C2H2 Zn finger 359..379 CDD:275368 10/19 (53%)
zf-H2C2_2 371..396 CDD:290200 12/24 (50%)
C2H2 Zn finger 387..407 CDD:275368 7/19 (37%)
zf-H2C2_2 400..424 CDD:290200 14/23 (61%)
C2H2 Zn finger 415..435 CDD:275368 9/19 (47%)
C2H2 Zn finger 527..547 CDD:275368 5/19 (26%)
zf-C2H2 553..575 CDD:278523 12/21 (57%)
C2H2 Zn finger 555..575 CDD:275368 11/19 (58%)
C2H2 Zn finger 583..603 CDD:275368 6/19 (32%)
zf-H2C2_2 596..620 CDD:290200 15/23 (65%)
C2H2 Zn finger 611..631 CDD:275368 9/19 (47%)
zf-H2C2_2 624..650 CDD:290200 10/25 (40%)
C2H2 Zn finger 639..661 CDD:275368 5/19 (26%)
ZNF479NP_001357058.1 KRAB 16..76 CDD:214630
COG5048 <170..372 CDD:227381 56/200 (28%)
C2H2 Zn finger 187..207 CDD:275368 114/345 (33%)
C2H2 Zn finger 215..235 CDD:275368 7/19 (37%)
C2H2 Zn finger 243..263 CDD:275368 10/19 (53%)
C2H2 Zn finger 271..291 CDD:275368 7/19 (37%)
C2H2 Zn finger 299..319 CDD:275368 9/19 (47%)
COG5048 <323..479 CDD:227381 52/193 (27%)
C2H2 Zn finger 327..347 CDD:275368 2/19 (11%)
C2H2 Zn finger 355..375 CDD:275368 3/55 (5%)
C2H2 Zn finger 383..403 CDD:275368 5/19 (26%)
C2H2 Zn finger 411..431 CDD:275368 11/19 (58%)
C2H2 Zn finger 439..459 CDD:275368 6/19 (32%)
C2H2 Zn finger 467..487 CDD:275368 9/19 (47%)
zf-H2C2_2 480..503 CDD:338759 9/24 (38%)
C2H2 Zn finger 495..515 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.