DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jim and ZNF695

DIOPT Version :9

Sequence 1:NP_001262221.1 Gene:jim / 43924 FlyBaseID:FBgn0027339 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_065127.5 Gene:ZNF695 / 57116 HGNCID:30954 Length:515 Species:Homo sapiens


Alignment Length:341 Identity:114/341 - (33%)
Similarity:151/341 - (44%) Gaps:86/341 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 KPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHANEKPF 385
            |.|::.:.::|..|||.|...|.|.:|.:|||..:|:.|.||||.|:...:||||.|||:.|||:
Human   260 KNHTEKKTYRCEECGKAFNLCSVLTKHKKIHTGEKPYKCEECGKSFKLFPYLTQHKRIHSREKPY 324

  Fly   386 TCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQDVSPHLIFKNGPHP 450
            .|..|.:.|:..:.|.||.|||:|||.|.|.||||.|.|.:.|.:|.|.|....|:         
Human   325 KCEECGKVFKLLSYLTQHRRIHTGEKTFRCEECGKAFNQSSHLTEHRRIHTGEKPY--------- 380

  Fly   451 TLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKGQKILPEVLQHIG 515
                                                                             
Human   381 ----------------------------------------------------------------- 380

  Fly   516 VRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKP 580
                      :|..|.|.|...:.|:||..||...:||.|.||||.|...|:||||.||||.|||
Human   381 ----------KCEECGKAFTWFSYLIQHKRIHTGQKPYKCEECGKAFTWFSYLTQHKRIHTGEKP 435

  Fly   581 FGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCR 645
            :.|..|.:.|...:.|..|.|||||||||||.:|||.|.|.:.|.:|...|..::|:.|  ..|.
Human   436 YKCDECGKAFNWFSYLTNHKRIHTGEKPYKCEECGKAFGQSSHLSKHKTIHTREKPYKC--EECG 498

  Fly   646 RRFATENEVTKHIDNH 661
            :.|....::..|...|
Human   499 KAFNHSAQLAVHEKTH 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jimNP_001262221.1 C2H2 Zn finger 331..351 CDD:275368 8/19 (42%)
COG5048 355..666 CDD:227381 101/307 (33%)
zf-C2H2 357..379 CDD:278523 11/21 (52%)
C2H2 Zn finger 359..379 CDD:275368 11/19 (58%)
zf-H2C2_2 371..396 CDD:290200 13/24 (54%)
C2H2 Zn finger 387..407 CDD:275368 7/19 (37%)
zf-H2C2_2 400..424 CDD:290200 16/23 (70%)
C2H2 Zn finger 415..435 CDD:275368 10/19 (53%)
C2H2 Zn finger 527..547 CDD:275368 7/19 (37%)
zf-C2H2 553..575 CDD:278523 13/21 (62%)
C2H2 Zn finger 555..575 CDD:275368 12/19 (63%)
C2H2 Zn finger 583..603 CDD:275368 6/19 (32%)
zf-H2C2_2 596..620 CDD:290200 17/23 (74%)
C2H2 Zn finger 611..631 CDD:275368 8/19 (42%)
zf-H2C2_2 624..650 CDD:290200 7/25 (28%)
C2H2 Zn finger 639..661 CDD:275368 4/21 (19%)
ZNF695NP_065127.5 KRAB 4..76 CDD:214630
COG5048 148..515 CDD:227381 114/341 (33%)
C2H2 Zn finger 158..178 CDD:275368
C2H2 Zn finger 186..206 CDD:275368
C2H2 Zn finger 214..234 CDD:275368
C2H2 Zn finger 242..262 CDD:275368 1/1 (100%)
C2H2 Zn finger 270..290 CDD:275368 8/19 (42%)
C2H2 Zn finger 298..318 CDD:275368 11/19 (58%)
C2H2 Zn finger 326..346 CDD:275368 7/19 (37%)
C2H2 Zn finger 354..374 CDD:275368 10/19 (53%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
C2H2 Zn finger 410..430 CDD:275368 12/19 (63%)
C2H2 Zn finger 438..458 CDD:275368 6/19 (32%)
C2H2 Zn finger 466..486 CDD:275368 8/19 (42%)
C2H2 Zn finger 494..514 CDD:275368 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.