DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jim and grau

DIOPT Version :9

Sequence 1:NP_001262221.1 Gene:jim / 43924 FlyBaseID:FBgn0027339 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_788422.1 Gene:grau / 45871 FlyBaseID:FBgn0001133 Length:570 Species:Drosophila melanogaster


Alignment Length:401 Identity:99/401 - (24%)
Similarity:147/401 - (36%) Gaps:102/401 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 RPHKNKPHSDLRLF-KCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIH 379
            |.|....|.|.|.: ||  ||:...::..:.:|.|.|.:.....|.:|||.|...|.|..|..:|
  Fly   256 REHFKDKHPDERPYIKC--CGRKLNKRCLIQEHARRHENPEYIKCKDCGKVFANSSVLRAHWLVH 318

  Fly   380 ---ANEKPFTCPYCSRSFRQRAILNQHIRIH--SGEKPFACPECGKHFRQKAILNQ-HVRTHQDV 438
               ..|..|.|..|.:.|.:|.:|..|...|  ..|:.|.||:|.||   .|...: |::.|  :
  Fly   319 HVPDEECDFQCEDCGKRFSRRNLLELHKGSHVPVNERKFICPQCPKH---NAFATEYHMQVH--I 378

  Fly   439 SPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKG 503
            |                                                                
  Fly   379 S---------------------------------------------------------------- 379

  Fly   504 QKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHI-ESRP---YPCPECGKRFRQ 564
                   :||  .:.||:     |.:|.|:.|.|....:|..:|. ||.|   .|.|:|....:.
  Fly   380 -------MQH--RKAANI-----CHVCGKKIKDKAVFEKHVRLHFEESGPRIKCPRPDCESWLKD 430

  Fly   565 QSHLTQHLRIHTNE-KPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHT 628
            :.:|.||||.|.:| |.|.|..|.:..:....|..|.|.......|.|.||||.|::...|.:|.
  Fly   431 EDNLKQHLRRHNDEGKLFICSECGKSCKNSRALIGHKRYSHSNVIYTCEQCGKTFKKDISLKEHM 495

  Fly   629 RTHQGDRPFCCPMPNCRRRFATENEVTKHIDNHMNPNTTKVRRQQQQQHQQQQQQQQQQQQQQQQ 693
            ..|.|:..:.||.  |.|.|.:...:..| ...|:|....:.|:.:.  ...|:.....|..|..
  Fly   496 AQHTGEPLYKCPF--CPRTFNSNANMHSH-KKKMHPVEWDIWRKTKT--GSSQKVLPSAQVAQMF 555

  Fly   694 QNNNAVAQVAN 704
            :::..||.:||
  Fly   556 RDDADVAAIAN 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jimNP_001262221.1 C2H2 Zn finger 331..351 CDD:275368 5/19 (26%)
COG5048 355..666 CDD:227381 79/321 (25%)
zf-C2H2 357..379 CDD:278523 8/21 (38%)
C2H2 Zn finger 359..379 CDD:275368 8/19 (42%)
zf-H2C2_2 371..396 CDD:290200 8/27 (30%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
zf-H2C2_2 400..424 CDD:290200 10/25 (40%)
C2H2 Zn finger 415..435 CDD:275368 7/20 (35%)
C2H2 Zn finger 527..547 CDD:275368 6/19 (32%)
zf-C2H2 553..575 CDD:278523 8/21 (38%)
C2H2 Zn finger 555..575 CDD:275368 7/19 (37%)
C2H2 Zn finger 583..603 CDD:275368 5/19 (26%)
zf-H2C2_2 596..620 CDD:290200 10/23 (43%)
C2H2 Zn finger 611..631 CDD:275368 8/19 (42%)
zf-H2C2_2 624..650 CDD:290200 9/25 (36%)
C2H2 Zn finger 639..661 CDD:275368 6/21 (29%)
grauNP_788422.1 zf-AD 3..77 CDD:285071
C2H2 Zn finger 272..290 CDD:275368 5/19 (26%)
COG5048 <296..453 CDD:227381 56/239 (23%)
C2H2 Zn finger 298..318 CDD:275368 8/19 (42%)
SIR2 <316..>415 CDD:294129 34/181 (19%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
C2H2 Zn finger 359..409 CDD:275368 19/132 (14%)
C2H2 Zn finger 360..378 CDD:275370 7/22 (32%)
zf-C2H2_8 419..495 CDD:292531 25/75 (33%)
C2H2 Zn finger 450..471 CDD:275368 5/20 (25%)
C2H2 Zn finger 478..498 CDD:275368 8/19 (42%)
C2H2 Zn finger 506..524 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5195
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.