DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jim and ZNF713

DIOPT Version :9

Sequence 1:NP_001262221.1 Gene:jim / 43924 FlyBaseID:FBgn0027339 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_872439.2 Gene:ZNF713 / 349075 HGNCID:22043 Length:443 Species:Homo sapiens


Alignment Length:303 Identity:97/303 - (32%)
Similarity:127/303 - (41%) Gaps:89/303 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 TCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQR 397
            |.|...|..|.|:.:...:....|:..|||||.|.|...||.|  ||..|||   ..|.::|...
Human   211 TQGNSIKHNSDLIYYQGNYVRETPYEYSECGKIFNQHILLTDH--IHTAEKP---SECGKAFSHT 270

  Fly   398 AILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVPFPGE 462
            :.|:|...:.:||||:.|.||||.|.|:..|.||.|.|....|.:                    
Human   271 SSLSQPQMLLTGEKPYKCDECGKRFSQRIHLIQHQRIHTGEKPFI-------------------- 315

  Fly   463 DNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKGQKILPEVLQHIGVRPANMPLYVRC 527
                                                                            |
Human   316 ----------------------------------------------------------------C 316

  Fly   528 PICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQ 592
            ..|.|.|:|.::..||..||...:||.|.:|||.|.:.:.||:|.|:||.|||:.|.:|.:.|.|
Human   317 NGCGKAFRQHSSFTQHLRIHTGEKPYKCNQCGKAFSRITSLTEHHRLHTGEKPYECGFCGKAFSQ 381

  Fly   593 RTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDR 635
            ||.||||.|.|||||||||.:|||.|.|.|.|:||.:.|..::
Human   382 RTHLNQHERTHTGEKPYKCNECGKAFSQSAHLNQHRKIHTREK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jimNP_001262221.1 C2H2 Zn finger 331..351 CDD:275368 5/17 (29%)
COG5048 355..666 CDD:227381 92/281 (33%)
zf-C2H2 357..379 CDD:278523 10/21 (48%)
C2H2 Zn finger 359..379 CDD:275368 10/19 (53%)
zf-H2C2_2 371..396 CDD:290200 10/24 (42%)
C2H2 Zn finger 387..407 CDD:275368 4/19 (21%)
zf-H2C2_2 400..424 CDD:290200 12/23 (52%)
C2H2 Zn finger 415..435 CDD:275368 11/19 (58%)
C2H2 Zn finger 527..547 CDD:275368 7/19 (37%)
zf-C2H2 553..575 CDD:278523 10/21 (48%)
C2H2 Zn finger 555..575 CDD:275368 9/19 (47%)
C2H2 Zn finger 583..603 CDD:275368 11/19 (58%)
zf-H2C2_2 596..620 CDD:290200 18/23 (78%)
C2H2 Zn finger 611..631 CDD:275368 10/19 (53%)
zf-H2C2_2 624..650 CDD:290200 4/12 (33%)
C2H2 Zn finger 639..661 CDD:275368
ZNF713NP_872439.2 KRAB 32..91 CDD:214630
KRAB 32..71 CDD:279668
C2H2 Zn finger 261..280 CDD:275368 4/18 (22%)
COG5048 284..>349 CDD:227381 28/148 (19%)
zf-C2H2 286..308 CDD:278523 11/21 (52%)
C2H2 Zn finger 288..308 CDD:275368 11/19 (58%)
zf-H2C2_2 300..325 CDD:290200 10/108 (9%)
C2H2 Zn finger 316..336 CDD:275368 7/19 (37%)
zf-H2C2_2 328..353 CDD:290200 11/24 (46%)
C2H2 Zn finger 344..364 CDD:275368 9/19 (47%)
zf-H2C2_2 356..381 CDD:290200 12/24 (50%)
C2H2 Zn finger 372..392 CDD:275368 11/19 (58%)
zf-H2C2_2 384..409 CDD:290200 18/24 (75%)
C2H2 Zn finger 400..420 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.