DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jim and dwg

DIOPT Version :9

Sequence 1:NP_001262221.1 Gene:jim / 43924 FlyBaseID:FBgn0027339 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster


Alignment Length:308 Identity:82/308 - (26%)
Similarity:118/308 - (38%) Gaps:84/308 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 FKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRS 393
            :.|..|.|.|:|:..|.||.|.|.|.:.:.|.|||||.:...:..:|:..|.|.||..|..|.|.
  Fly   305 YVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRF 369

  Fly   394 FRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVP 458
            :|..:.|..|.|.|:.:||:.|.:||:.:    ....|:|.|:                      
  Fly   370 YRTTSSLAVHKRTHAEKKPYNCDQCGRGY----AAFDHLRRHK---------------------- 408

  Fly   459 FPGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKGQKILPEVLQHIGVRPANMPL 523
                                                                |.|.|.||     
  Fly   409 ----------------------------------------------------LTHTGERP----- 416

  Fly   524 YVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPR 588
             ..|.:|||.:...::|.||...|...:.:.|..||....|:|...:|:.:|:..|...|..|..
  Fly   417 -YACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGH 480

  Fly   589 FFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRP 636
            .|...:.||.|:|:|:||||:||..|.|.|..|..|..|.|.|..:.|
  Fly   481 AFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESP 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jimNP_001262221.1 C2H2 Zn finger 331..351 CDD:275368 9/19 (47%)
COG5048 355..666 CDD:227381 71/282 (25%)
zf-C2H2 357..379 CDD:278523 7/21 (33%)
C2H2 Zn finger 359..379 CDD:275368 7/19 (37%)
zf-H2C2_2 371..396 CDD:290200 8/24 (33%)
C2H2 Zn finger 387..407 CDD:275368 7/19 (37%)
zf-H2C2_2 400..424 CDD:290200 9/23 (39%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
C2H2 Zn finger 527..547 CDD:275368 7/19 (37%)
zf-C2H2 553..575 CDD:278523 6/21 (29%)
C2H2 Zn finger 555..575 CDD:275368 6/19 (32%)
C2H2 Zn finger 583..603 CDD:275368 7/19 (37%)
zf-H2C2_2 596..620 CDD:290200 14/23 (61%)
C2H2 Zn finger 611..631 CDD:275368 8/19 (42%)
zf-H2C2_2 624..650 CDD:290200 5/13 (38%)
C2H2 Zn finger 639..661 CDD:275368
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 52/229 (23%)
C2H2 Zn finger 307..327 CDD:275368 9/19 (47%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
COG5048 <387..523 CDD:227381 50/219 (23%)
C2H2 Zn finger 391..411 CDD:275368 7/97 (7%)
zf-H2C2_2 403..426 CDD:290200 12/102 (12%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
C2H2 Zn finger 447..467 CDD:275368 6/19 (32%)
C2H2 Zn finger 475..495 CDD:275368 7/19 (37%)
zf-H2C2_2 487..510 CDD:290200 13/22 (59%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.