DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jim and Zfp664

DIOPT Version :9

Sequence 1:NP_001262221.1 Gene:jim / 43924 FlyBaseID:FBgn0027339 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_001075219.1 Gene:Zfp664 / 269704 MGIID:2442505 Length:261 Species:Mus musculus


Alignment Length:308 Identity:101/308 - (32%)
Similarity:141/308 - (45%) Gaps:56/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 LFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSR 392
            ::||..|.:.|.:::.|..|.:|||..:|..|.:|.|.|...|.|..|.|.|..||.:.|..|.:
Mouse     2 IYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGK 66

  Fly   393 SFRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDV 457
            .|.....||:|.:||:.|||:.|.||||.|...:.|..|:|.|....|::               
Mouse    67 DFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHTGEKPYV--------------- 116

  Fly   458 PFPGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKGQKILPEVLQHIGVRPANMP 522
                        .:..|.|:.:..:.       .||          |::      |.|.:|    
Mouse   117 ------------CSECGRGFSNSSNL-------CMH----------QRV------HTGEKP---- 142

  Fly   523 LYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCP 587
              .:|..|.|.|:..::|..|..:|...:||.|.||||.|.|.|.|..|.|:||.|||:.|..|.
Mouse   143 --FKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCG 205

  Fly   588 RFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDR 635
            :.|.|.:.|..|.|:||||||:||.:|||.|.|...|..|.|.|..:|
Mouse   206 KAFSQSSSLCIHQRVHTGEKPFKCDECGKAFSQSTSLCIHQRVHTKER 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jimNP_001262221.1 C2H2 Zn finger 331..351 CDD:275368 5/19 (26%)
COG5048 355..666 CDD:227381 92/281 (33%)
zf-C2H2 357..379 CDD:278523 8/21 (38%)
C2H2 Zn finger 359..379 CDD:275368 8/19 (42%)
zf-H2C2_2 371..396 CDD:290200 9/24 (38%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
zf-H2C2_2 400..424 CDD:290200 14/23 (61%)
C2H2 Zn finger 415..435 CDD:275368 9/19 (47%)
C2H2 Zn finger 527..547 CDD:275368 6/19 (32%)
zf-C2H2 553..575 CDD:278523 12/21 (57%)
C2H2 Zn finger 555..575 CDD:275368 11/19 (58%)
C2H2 Zn finger 583..603 CDD:275368 7/19 (37%)
zf-H2C2_2 596..620 CDD:290200 15/23 (65%)
C2H2 Zn finger 611..631 CDD:275368 9/19 (47%)
zf-H2C2_2 624..650 CDD:290200 5/12 (42%)
C2H2 Zn finger 639..661 CDD:275368
Zfp664NP_001075219.1 C2H2 Zn finger 5..25 CDD:275368 5/19 (26%)
C2H2 Zn finger 33..53 CDD:275368 8/19 (42%)
C2H2 Zn finger 61..81 CDD:275368 6/19 (32%)
zf-H2C2_2 74..97 CDD:404364 13/22 (59%)
C2H2 Zn finger 89..109 CDD:275368 9/19 (47%)
COG5048 <94..256 CDD:227381 65/216 (30%)
C2H2 Zn finger 117..137 CDD:275368 5/42 (12%)
C2H2 Zn finger 145..165 CDD:275368 6/19 (32%)
C2H2 Zn finger 173..193 CDD:275368 11/19 (58%)
C2H2 Zn finger 201..221 CDD:275368 7/19 (37%)
C2H2 Zn finger 229..249 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.