DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jim and ZNF460

DIOPT Version :9

Sequence 1:NP_001262221.1 Gene:jim / 43924 FlyBaseID:FBgn0027339 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_006626.3 Gene:ZNF460 / 10794 HGNCID:21628 Length:562 Species:Homo sapiens


Alignment Length:415 Identity:122/415 - (29%)
Similarity:184/415 - (44%) Gaps:71/415 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 FKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRS 393
            :.|..|||.|.:...||||..|||..:|:.|.||||.|.::||||:|.|.|..:|||.|..|.|:
Human   196 YDCPECGKAFGKSKHLLQHHIIHTGEKPYKCLECGKDFNRRSHLTRHQRTHNGDKPFVCSECGRT 260

  Fly   394 FRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVP 458
            |.:.:.|.:|.|:|||||||.|.||||.|..::....|.::|.:..|..                
Human   261 FNRGSHLTRHQRVHSGEKPFVCNECGKAFTYRSNFVLHNKSHNEKKPFA---------------- 309

  Fly   459 FPGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKGQKILPEVLQHIGVRPANMPL 523
                       .:..|.|:::..:                       ::...:.|.|.||     
Human   310 -----------CSECGKGFYESTA-----------------------LIQHFIIHTGERP----- 335

  Fly   524 YVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPR 588
             .:|..|.|.|..::.|.||..||...:|:.|.:|||.|...|....|.|.||.||||.|..|.:
Human   336 -FKCLECGKAFNCRSHLKQHERIHTGEKPFVCSQCGKAFTHYSTYVLHERAHTGEKPFECKECGK 399

  Fly   589 FFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCRRRFATENE 653
            .|..|..|.:|..||||||||:|.||||.|.:.:.|.:|...|.|::|:.|  ..|.:.|.....
Human   400 AFSIRKDLIRHFNIHTGEKPYECLQCGKAFTRMSGLTRHQWIHTGEKPYVC--IQCGKAFCRTTN 462

  Fly   654 VTKHIDNHMNPNTTKV--------RRQQQQQHQQQQQQQQQQQQQQQQQNNNAVAQVANH--LMN 708
            :.:|...|......:.        ||....:||:....::..:..|....:.....:..|  :..
Human   463 LIRHFSIHTGEKPYECVECGKAFNRRSPLTRHQRIHTAEKSHEPIQSGNVSCESTDLIQHSIIHT 527

  Fly   709 DAKSLAAQQFLNNNNPSAVDNKANI 733
            ::..::|   :|...||...:.:::
Human   528 ESSPVSA---VNMETPSIAAHSSSL 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jimNP_001262221.1 C2H2 Zn finger 331..351 CDD:275368 9/19 (47%)
COG5048 355..666 CDD:227381 100/310 (32%)
zf-C2H2 357..379 CDD:278523 12/21 (57%)
C2H2 Zn finger 359..379 CDD:275368 12/19 (63%)
zf-H2C2_2 371..396 CDD:290200 13/24 (54%)
C2H2 Zn finger 387..407 CDD:275368 7/19 (37%)
zf-H2C2_2 400..424 CDD:290200 16/23 (70%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
C2H2 Zn finger 527..547 CDD:275368 7/19 (37%)
zf-C2H2 553..575 CDD:278523 8/21 (38%)
C2H2 Zn finger 555..575 CDD:275368 8/19 (42%)
C2H2 Zn finger 583..603 CDD:275368 6/19 (32%)
zf-H2C2_2 596..620 CDD:290200 16/23 (70%)
C2H2 Zn finger 611..631 CDD:275368 8/19 (42%)
zf-H2C2_2 624..650 CDD:290200 8/25 (32%)
C2H2 Zn finger 639..661 CDD:275368 4/21 (19%)
ZNF460NP_006626.3 KRAB 12..53 CDD:307490
C2H2 Zn finger 198..218 CDD:275368 9/19 (47%)
COG5048 222..552 CDD:227381 110/389 (28%)
C2H2 Zn finger 226..246 CDD:275368 12/19 (63%)
C2H2 Zn finger 254..274 CDD:275368 7/19 (37%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..330 CDD:275368 2/42 (5%)
C2H2 Zn finger 338..358 CDD:275368 7/19 (37%)
C2H2 Zn finger 366..386 CDD:275368 8/19 (42%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
C2H2 Zn finger 422..442 CDD:275368 8/19 (42%)
C2H2 Zn finger 450..470 CDD:275368 4/21 (19%)
C2H2 Zn finger 478..498 CDD:275368 4/19 (21%)
C2H2 Zn finger 506..526 CDD:275368 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.