DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jim and ZNF730

DIOPT Version :9

Sequence 1:NP_001262221.1 Gene:jim / 43924 FlyBaseID:FBgn0027339 Length:938 Species:Drosophila melanogaster
Sequence 2:XP_016881603.1 Gene:ZNF730 / 100129543 HGNCID:32470 Length:514 Species:Homo sapiens


Alignment Length:344 Identity:118/344 - (34%)
Similarity:159/344 - (46%) Gaps:87/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 HKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHANE 382
            || :.|:..:.::|..|||.|.|.:.|..|.||||..:|:.|.||||.|.|.|:||:|.:||..|
Human   257 HK-RIHTGEKPYQCEKCGKFFNQSTNLTTHKRIHTGEKPYKCEECGKAFNQSSNLTEHKKIHTKE 320

  Fly   383 KPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQDVSPHLIFKNG 447
            :|:.|..|.::|:..:.|.:|.|||:||||:.|.||||.|.:.:.||:|..||            
Human   321 QPYKCEKCGKAFKWSSTLTKHKRIHNGEKPYKCEECGKAFNRSSTLNRHKITH------------ 373

  Fly   448 PHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKGQKILPEVLQ 512
                                     |||                  .|..:|:            
Human   374 -------------------------TGG------------------KPYKYKE------------ 383

  Fly   513 HIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTN 577
                             |.|.|.|.:||..|..||...:.|.|.||||.|.:.||||.|.||||.
Human   384 -----------------CGKAFNQSSTLTIHKIIHTVEKFYKCEECGKAFSRISHLTTHKRIHTG 431

  Fly   578 EKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPFCCPMP 642
            |||:.|..|.|.|.|.:.|..|.|||||||||:|.:|||.|.:.:.|..|...|.|::.:.|  .
Human   432 EKPYKCEECGRAFNQSSTLTTHKRIHTGEKPYECEECGKAFNRSSTLTTHKIIHSGEKIYKC--K 494

  Fly   643 NCRRRFATENEVTKHIDNH 661
            .|.:.|...:.:|:|...|
Human   495 ECGKAFRRFSHLTRHKTIH 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jimNP_001262221.1 C2H2 Zn finger 331..351 CDD:275368 9/19 (47%)
COG5048 355..666 CDD:227381 103/307 (34%)
zf-C2H2 357..379 CDD:278523 11/21 (52%)
C2H2 Zn finger 359..379 CDD:275368 11/19 (58%)
zf-H2C2_2 371..396 CDD:290200 10/24 (42%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
zf-H2C2_2 400..424 CDD:290200 15/23 (65%)
C2H2 Zn finger 415..435 CDD:275368 9/19 (47%)
C2H2 Zn finger 527..547 CDD:275368 7/19 (37%)
zf-C2H2 553..575 CDD:278523 13/21 (62%)
C2H2 Zn finger 555..575 CDD:275368 12/19 (63%)
C2H2 Zn finger 583..603 CDD:275368 8/19 (42%)
zf-H2C2_2 596..620 CDD:290200 16/23 (70%)
C2H2 Zn finger 611..631 CDD:275368 7/19 (37%)
zf-H2C2_2 624..650 CDD:290200 7/25 (28%)
C2H2 Zn finger 639..661 CDD:275368 5/21 (24%)
ZNF730XP_016881603.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.