DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axo and spint1b

DIOPT Version :10

Sequence 1:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster
Sequence 2:NP_001104693.2 Gene:spint1b / 797346 ZFINID:ZDB-GENE-071218-1 Length:501 Species:Danio rerio


Alignment Length:59 Identity:22/59 - (37%)
Similarity:35/59 - (59%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 NQYEKCAGPGDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHCIG 172
            |:...|..|...|||:.:.:.|.|:|.:.:|..|.:|||:|| :|.|.|..:|:.:|.|
Zfish   360 NKKAHCTDPPATGPCRAHFHHWYYDPLSKKCHPFTYGGCDGN-RNNFETADKCMKNCSG 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axoNP_001246631.1 Kunitz-type 119..170 CDD:438633 19/50 (38%)
Laminin_G_2 275..413 CDD:460494
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:460494
Laminin_G_2 698..817 CDD:460494
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:460494
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:460494
Laminin_G_2 1612..1733 CDD:460494
PHA03247 <1895..2164 CDD:223021
spint1bNP_001104693.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.