DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axo and EPPIN

DIOPT Version :9

Sequence 1:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster
Sequence 2:NP_065131.1 Gene:EPPIN / 57119 HGNCID:15932 Length:133 Species:Homo sapiens


Alignment Length:52 Identity:22/52 - (42%)
Similarity:30/52 - (57%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CAGPGDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHC 170
            |..|.:.|||..|...|.|:...|.|:.|::|||:|| .|.|.::|.||..|
Human    77 CEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGN-NNNFQSKANCLNTC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axoNP_001246631.1 KU 119..171 CDD:238057 22/52 (42%)
Laminin_G_2 275..411 CDD:280389
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:280389
Laminin_G_2 698..817 CDD:280389
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:280389
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:280389
LamG 1612..1733 CDD:304605
EPPINNP_065131.1 WAP 30..70 CDD:306578
Kunitz_BPTI 76..128 CDD:278443 22/52 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.