DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axo and col6a4a

DIOPT Version :9

Sequence 1:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster
Sequence 2:XP_017207020.1 Gene:col6a4a / 564005 ZFINID:ZDB-GENE-041111-303 Length:2568 Species:Danio rerio


Alignment Length:152 Identity:43/152 - (28%)
Similarity:58/152 - (38%) Gaps:53/152 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PDT------GGGNSAGGSPAGGSS---------GT-----------------------GGGGSNS 98
            |:|      |.|:|...|||..:.         ||                       ||.|.|.
Zfish  2412 PETEDQQSSGRGDSIIQSPADNTDSLCRQSSDRGTVCGDYMQRWYYNPAVRGCLPFWYGGCGGNG 2476

  Fly    99 GISGNNSAMIQ--GQKSNQY------------EKCAGPGDPGPCKQYIYKWRYEPTTNECTNFIW 149
            ....:....:|  |:|:.:.            :.|....|.|||..|:..|.|:...|||:.|.:
Zfish  2477 NRFSSERECLQTCGKKNPEVIPQTQVETALFNDACLMKQDVGPCSNYVLSWYYDIQQNECSQFWF 2541

  Fly   150 GGCEGNPQNRFGTEAECLFHCI 171
            |||||| :|||.|.|||...|:
Zfish  2542 GGCEGN-KNRFETRAECEALCL 2562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axoNP_001246631.1 KU 119..171 CDD:238057 25/51 (49%)
Laminin_G_2 275..411 CDD:280389
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:280389
Laminin_G_2 698..817 CDD:280389
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:280389
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:280389
LamG 1612..1733 CDD:304605
col6a4aXP_017207020.1 vWA_collagen 35..198 CDD:238749
VWA 230..>362 CDD:278519
VWA 416..588 CDD:278519
VWA 622..784 CDD:278519
VWA 807..975 CDD:278519
VWA 995..1164 CDD:278519
vWA_collagen 1184..1351 CDD:238749
VWA <1451..1548 CDD:214621
Collagen 1584..1676 CDD:189968
Collagen 1659..1739 CDD:189968
Collagen 1786..1840 CDD:189968
Collagen 1842..1912 CDD:189968
VWA 1943..2107 CDD:278519
VWA 2153..2325 CDD:278519
Kunitz_BPTI 2438..2490 CDD:278443 7/51 (14%)
Kunitz_BPTI 2510..2561 CDD:278443 25/51 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.