DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axo and ambp

DIOPT Version :10

Sequence 1:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster
Sequence 2:NP_957412.2 Gene:ambp / 394093 ZFINID:ZDB-GENE-040426-1608 Length:346 Species:Danio rerio


Alignment Length:70 Identity:25/70 - (35%)
Similarity:35/70 - (50%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SGNNSAMIQGQKSNQYEKCAGPGDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAE 165
            ||::..|.:|.     :.|....|.|||...:.::.|..:...|..|.:|||.|| ||.|.||.:
Zfish   212 SGDDMPMFRGP-----DACKSEPDSGPCFGMLTRFHYNSSIMSCQMFTFGGCMGN-QNNFPTEKD 270

  Fly   166 CLFHC 170
            ||..|
Zfish   271 CLQSC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axoNP_001246631.1 Kunitz-type 119..170 CDD:438633 20/50 (40%)
Laminin_G_2 275..413 CDD:460494
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:460494
Laminin_G_2 698..817 CDD:460494
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:460494
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:460494
Laminin_G_2 1612..1733 CDD:460494
PHA03247 <1895..2164 CDD:223021
ambpNP_957412.2 lipocalin_A1M-like 24..186 CDD:381193
Kunitz_bikunin_1-like 223..276 CDD:438639 21/54 (39%)
Kunitz_bikunin_2-like 278..332 CDD:438640
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.