DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axo and APP

DIOPT Version :9

Sequence 1:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster
Sequence 2:NP_000475.1 Gene:APP / 351 HGNCID:620 Length:770 Species:Homo sapiens


Alignment Length:551 Identity:118/551 - (21%)
Similarity:191/551 - (34%) Gaps:151/551 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EKCAGPGDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHCIGGPHTLPPFL 181
            |.|:...:.|||:..|.:|.::.|..:|..|.:|||.|| :|.|.||..|:..|   ...:...|
Human   289 EVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGN-RNNFDTEEYCMAVC---GSAMSQSL 349

  Fly   182 QSTTREPSTTESSMLLGLPYTQSPAQSPDGMGGAEGGDGTTPVPIEQRGPELTFAETGQGKTFIF 246
            ..||:||...:.   :.||.|  .|.:||.:...          :|..|.|...|...:.|..:.
Human   350 LKTTQEPLARDP---VKLPTT--AASTPDAVDKY----------LETPGDENEHAHFQKAKERLE 399

  Fly   247 AKNNTFIQM----------------DGD---IIQTFQLRL--CREISFQFRTRL--PHGLLVYHN 288
            ||:...:..                ..|   :||.||.::  ..:.:...|.:|  .|...|...
Human   400 AKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAM 464

  Fly   289 VKNPDRINLDPY--ALYVIVEKGQLKVVHVFGKHSTSVTVGESLNRDEWHSVM----VR-IDVHG 346
            :.:..|:.|:.|  ||..:..:.:    |||......|...:   :|..|::.    || :|...
Human   465 LNDRRRLALENYITALQAVPPRPR----HVFNMLKKYVRAEQ---KDRQHTLKHFEHVRMVDPKK 522

  Fly   347 ARLIARVDNSQEEVYLKGLNHEYNYGVST--NLPSV---------------------VLVGGLSS 388
            |..|    .||...:|:.:....|..:|.  |:|:|                     ||...:|.
Human   523 AAQI----RSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISE 583

  Fly   389 EEKLHGVKYITESFVGCIRNVVLSSGKAASDLLPIAPLVATKHENVNEGCSDMCESRHNLCFVGS 453
            ....:|...:..|         |:..|...:|||:.          .|...|..:..|:      
Human   584 PRISYGNDALMPS---------LTETKTTVELLPVN----------GEFSLDDLQPWHS------ 623

  Fly   454 RCINHYGGISCDCFGTHYEGEHCDIYTAT---IITLRGASYVSYRIYDWKDRVHSSTRRISLMFR 515
                 :|..|... .|..|.|..|...|.   :.|..|:...:.:           |..||.:..
Human   624 -----FGADSVPA-NTENEVEPVDARPAADRGLTTRPGSGLTNIK-----------TEEISEVKM 671

  Fly   516 TNFDDSALFYASGESLKHQ---YIAASI-KNQSVHVEMDFGDNVMSTVLTDDLTRGYWHNLTILH 576
                |:...:.||..:.||   :.|..: .|:...:.:..|..|::||:...|........|.:|
Human   672 ----DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIH 732

  Fly   577 ------------EQRTVSIILDQQQKVLELP 595
                        |:|.:|   ..||...|.|
Human   733 HGVVEVDAAVTPEERHLS---KMQQNGYENP 760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axoNP_001246631.1 KU 119..171 CDD:238057 19/51 (37%)
Laminin_G_2 275..411 CDD:280389 33/167 (20%)
EGF_CA 433..476 CDD:238011 8/42 (19%)
Laminin_G_2 514..640 CDD:280389 21/98 (21%)
Laminin_G_2 698..817 CDD:280389
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:280389
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:280389
LamG 1612..1733 CDD:304605
APPNP_000475.1 A4_EXTRA 24..188 CDD:128326
GFLD subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01217 28..123
Heparin-binding. /evidence=ECO:0000269|PubMed:8158260 96..110
CuBD subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01217 131..189
Zinc-binding 181..188
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..284
Kunitz_BPTI 294..341 CDD:333766 18/47 (38%)
OX-2. /evidence=ECO:0000269|PubMed:2649245 344..365 5/23 (22%)
APP_E2 366..548 CDD:372388 41/204 (20%)
Heparin-binding 391..423 3/31 (10%)
Heparin-binding 491..522 7/33 (21%)
Collagen-binding. /evidence=ECO:0000269|PubMed:8576160 523..540 5/20 (25%)
Beta-APP 677..713 CDD:367525 8/35 (23%)
Interaction with PSEN1. /evidence=ECO:0000269|PubMed:30630874 695..722 6/26 (23%)
APP_amyloid 716..766 CDD:371108 10/48 (21%)
Basolateral sorting signal 724..734 2/9 (22%)
Interaction with G(o)-alpha 732..751 4/21 (19%)
Required for the interaction with KIF5B and for anterograde transport in axons. /evidence=ECO:0000269|PubMed:17062754 756..770 2/5 (40%)
YENPXY motif, contains endocytosis signal. /evidence=ECO:0000269|PubMed:10383380 757..762 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.