DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axo and Spint1

DIOPT Version :10

Sequence 1:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster
Sequence 2:NP_001004265.2 Gene:Spint1 / 311331 RGDID:1303138 Length:507 Species:Rattus norvegicus


Alignment Length:54 Identity:24/54 - (44%)
Similarity:30/54 - (55%) Gaps:1/54 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CAGPGDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHCIG 172
            ||...|.|.||:.|.:|.|.|.:..|..|.:|||.|| :|.|..|.:||..|.|
  Rat   369 CAELPDTGFCKENIPRWYYNPFSERCARFTYGGCYGN-KNNFEKEQQCLESCRG 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axoNP_001246631.1 Kunitz-type 119..170 CDD:438633 22/50 (44%)
Laminin_G_2 275..413 CDD:460494
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:460494
Laminin_G_2 698..817 CDD:460494
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:460494
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:460494
Laminin_G_2 1612..1733 CDD:460494
PHA03247 <1895..2164 CDD:223021
Spint1NP_001004265.2 MANEC 42..133 CDD:462186
Kunitz_HAI1_1-like 239..297 CDD:438666
LDLa 313..344 CDD:197566
Kunitz_HAI1_2-like 369..428 CDD:438667 24/54 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.