DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axo and Appl

DIOPT Version :9

Sequence 1:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster
Sequence 2:NP_001245448.1 Gene:Appl / 31002 FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster


Alignment Length:261 Identity:55/261 - (21%)
Similarity:97/261 - (37%) Gaps:63/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1872 VKAGLLGGVTAGSGNGLPPYTYKALPQEDKKPGNGAPLVGILKNGSATPSQ-------------- 1922
            :.:|..||:.|.:..  .|.|.:.|...|:.......::......||..:|              
  Fly   544 LNSGGPGGLEAAASE--RPRTLERLIDIDRAVNQSMTMLKRYPELSAKIAQLMNDYILALRSKDD 606

  Fly  1923 -PGTPTALSKNG----------DIASRIEEEEE---EEDEAPAQKAAEKSGENEEP---PAK--- 1967
             ||:...:|:..          :|..::.|:|.   .|.:...|:|||:....||.   .||   
  Fly   607 IPGSSLGMSEEAEAGILDKYRVEIERKVAEKERLRLAEKQRKEQRAAEREKLREEKLRLEAKKVD 671

  Fly  1968 DTTASEIKESQAQPPEQLAKDTTDASAAPKASKETEAQAEPSE---PSSQLNSAQNGQL--AQME 2027
            |...|::.|.|:||        |.:|...:|.::.:.::.|.:   |.:.|.:|.|..|  .:.|
  Fly   672 DMLKSQVAEQQSQP--------TQSSTQSQAQQQQQEKSLPGKELGPDAALVTAANPNLETTKSE 728

  Fly  2028 QAARGDEVQVPSLPHPIQPPDAIFMPNLPQKAQQRQPQEHKSRHKATDDTEAPKQQQQQQQQQQS 2092
            :.....|....::...:|    ..:|.:...|.||          |.:|..|....|:.:.|.|.
  Fly   729 KDLSDTEYGEATVSTKVQ----TVLPTVDDDAVQR----------AVEDVAAAVAHQEAEPQVQH 779

  Fly  2093 F 2093
            |
  Fly   780 F 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axoNP_001246631.1 KU 119..171 CDD:238057
Laminin_G_2 275..411 CDD:280389
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:280389
Laminin_G_2 698..817 CDD:280389
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:280389
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:280389
LamG 1612..1733 CDD:304605
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326
APP_N 33..141 CDD:280358
APP_Cu_bd 143..198 CDD:289676
APP_E2 387..580 CDD:289677 8/37 (22%)
GBP_C <629..682 CDD:303769 15/52 (29%)
APP_amyloid 834..887 CDD:287486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.