DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axo and Wfdc5

DIOPT Version :10

Sequence 1:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster
Sequence 2:NP_001100008.1 Gene:Wfdc5 / 296352 RGDID:1304986 Length:123 Species:Rattus norvegicus


Alignment Length:98 Identity:24/98 - (24%)
Similarity:36/98 - (36%) Gaps:40/98 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly  1259 CKPS---C---VPSPCRNGAQCKELWSSFKCVCNNPWAHIGEFCETNINEKALTFINRESFLM-- 1315
            |.|.   |   :|..|.|..||.   ||:||            |            :|..||.  
  Rat    34 CPPDDGPCSQVIPDQCANDKQCP---SSWKC------------C------------SRACFLQCM 71

  Fly  1316 -RNYLSVGATPVILMHGINGERDVLKGILNQDL 1347
             |.::.:|..||..:|.::..    |.:.::||
  Rat    72 PRVFVKLGKCPVDQLHCLSPR----KHLCDKDL 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axoNP_001246631.1 Kunitz-type 119..170 CDD:438633
Laminin_G_2 275..413 CDD:460494
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:460494
Laminin_G_2 698..817 CDD:460494
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:460494
EGF_CA 1256..1297 CDD:238011 12/43 (28%)
Laminin_G_2 1351..1503 CDD:460494
Laminin_G_2 1612..1733 CDD:460494
PHA03247 <1895..2164 CDD:223021
Wfdc5NP_001100008.1 WAP 62..120 CDD:469631 12/55 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.