DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axo and Wfdc6a

DIOPT Version :10

Sequence 1:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster
Sequence 2:XP_011237710.1 Gene:Wfdc6a / 209351 MGIID:2684968 Length:193 Species:Mus musculus


Alignment Length:52 Identity:26/52 - (50%)
Similarity:33/52 - (63%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CAGPGDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHC 170
            |:.|.|||||..|:.:|.|...|:.||.||:|||:||| |.|.:|..|...|
Mouse   134 CSLPQDPGPCLAYLPRWWYNQETDLCTEFIYGGCQGNP-NNFPSEGICTVVC 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axoNP_001246631.1 Kunitz-type 119..170 CDD:438633 25/50 (50%)
Laminin_G_2 275..413 CDD:460494
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:460494
Laminin_G_2 698..817 CDD:460494
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:460494
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:460494
Laminin_G_2 1612..1733 CDD:460494
PHA03247 <1895..2164 CDD:223021
Wfdc6aXP_011237710.1 WAP 89..128 CDD:459672
Kunitz_eppin 132..188 CDD:438654 26/52 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.