DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment axo and C54D10.10

DIOPT Version :9

Sequence 1:	NP_001246631.1	Gene:	axo / 43923	FlyBaseID:	FBgn0262870	Length:	2179	Species:	Drosophila melanogaster
Sequence 2:	NP_506123.2	Gene:	C54D10.10 / 183787	WormBaseID:	WBGene00008304	Length:	216	Species:	Caenorhabditis elegans

Alignment Length:	77	Identity:	23/77 - (29%)
Similarity:	32/77 - (41%)	Gaps:	11/77 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   119 CAGPGDPG-PC--KQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHCIGGPHTLPPF 180
            |....|.| .|  |....|:.::..||.|....:.||.|| :|||.:...|...|:  ||.
Worm    21 CRQEKDTGVNCDNKPITLKFYFDMRTNVCQPLFYRGCGGN-ENRFESRDACSDACV--PHK---- 78

  Fly   181 LQSTTREPSTTE 192
             ...|::|...|
Worm    79 -PGKTKKPEKKE 89

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
axo	NP_001246631.1	KU	119..171	CDD:238057	17/54 (31%)
		Laminin_G_2	275..411	CDD:280389
		EGF_CA	433..476	CDD:238011
		Laminin_G_2	514..640	CDD:280389
		Laminin_G_2	698..817	CDD:280389
		EGF_CA	842..878	CDD:238011
		Laminin_G_2	1112..1240	CDD:280389
		EGF_CA	1256..1297	CDD:238011
		Laminin_G_2	1351..1503	CDD:280389
		LamG	1612..1733	CDD:304605
C54D10.10	NP_506123.2	Kunitz_BPTI	21..75	CDD:278443	17/54 (31%)
C54D10.10	NP_506123.2	KU	158..214	CDD:238057
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810