DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment axo and E01G6.1

DIOPT Version :9

Sequence 1:	NP_001246631.1	Gene:	axo / 43923	FlyBaseID:	FBgn0262870	Length:	2179	Species:	Drosophila melanogaster
Sequence 2:	NP_510044.2	Gene:	E01G6.1 / 181387	WormBaseID:	WBGene00008449	Length:	1467	Species:	Caenorhabditis elegans

Alignment Length:	150	Identity:	32/150 - (21%)
Similarity:	50/150 - (33%)	Gaps:	48/150 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly    87 GSSGTGGG-------------GSNSGISG-----NNSAMIQ----------GQKSNQYEKCAGPG 123
            |.||.|..             .::|...|     |.::.:|          |.:.|....|. |.
Worm   474 GCSGNGNNFETVDQCQNFCLHSADSACDGLVPLKNPNSELQRCSEEDPCPAGYECNDSSYCC-PS 537

  Fly   124 DPGPCKQYIYK------------WRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHCIGG--- 173
            ....|...:.:            |.|:.:..:|:.|::.||.|.| |||.|:..|...|:..
Worm   538 SENACNANMSRGNGCKGSTQRSMWFYDKSKKKCSQFVYNGCGGTP-NRFTTKVACTESCVQSSAF 601

  Fly   174 ---PHTLPPFLQSTTREPST 190
               |..:.||.:.....|.|
Worm   602 GLCPRGMNPFTEEGEITPKT 621

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
axo	NP_001246631.1	KU	119..171	CDD:238057	16/63 (25%)
		Laminin_G_2	275..411	CDD:280389
		EGF_CA	433..476	CDD:238011
		Laminin_G_2	514..640	CDD:280389
		Laminin_G_2	698..817	CDD:280389
		EGF_CA	842..878	CDD:238011
		Laminin_G_2	1112..1240	CDD:280389
		EGF_CA	1256..1297	CDD:238011
		Laminin_G_2	1351..1503	CDD:280389
		LamG	1612..1733	CDD:304605
E01G6.1	NP_510044.2	Lustrin_cystein	95..136	CDD:291299
		WR1	289..325	CDD:214601
		Kunitz_BPTI	330..386	CDD:278443
		Kunitz_BPTI	437..492	CDD:278443	4/17 (24%)
		Kunitz_BPTI	541..596	CDD:278443	14/55 (25%)
		Lustrin_cystein	860..902	CDD:291299
		Lustrin_cystein	909..951	CDD:291299
		Lustrin_cystein	963..1006	CDD:291299
		EB	1265..1321	CDD:279949
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810