powered by:
Protein Alignment axo and C02F12.5
DIOPT Version :9
Sequence 1: | NP_001246631.1 |
Gene: | axo / 43923 |
FlyBaseID: | FBgn0262870 |
Length: | 2179 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508632.2 |
Gene: | C02F12.5 / 180656 |
WormBaseID: | WBGene00015355 |
Length: | 176 |
Species: | Caenorhabditis elegans |
Alignment Length: | 124 |
Identity: | 27/124 - (21%) |
Similarity: | 32/124 - (25%) |
Gaps: | 52/124 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 KWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHCIGGPHTLPPFLQSTTREPSTTESSMLLG 198
||.|:.....|..:.:.|| |...|.|.:...||..|
Worm 39 KWYYDSKLLFCYPYKYLGC-GEGSNSFESNENCLESC---------------------------- 74
Fly 199 LPYTQSPAQSPDGMGGAEGGDGTTPVPIEQRGPELTFAETGQGKTFIFAKNNTFIQMDG 257
.||.. ...||..|.|| :.||...|| .|..|...|.|
Worm 75 -----KPADQ-FSCGGNTGPDG------------VCFAHGDQG-----CKKGTVCVMGG 110
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.