DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axo and Y43F8B.3

DIOPT Version :9

Sequence 1:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster
Sequence 2:NP_001256874.1 Gene:Y43F8B.3 / 180277 WormBaseID:WBGene00012814 Length:1658 Species:Caenorhabditis elegans


Alignment Length:323 Identity:66/323 - (20%)
Similarity:96/323 - (29%) Gaps:111/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ICSASGLSLPNMTSTD-AVVAGGGILP----------ILVAGNPGNLGSSNMSLS---------- 56
            :|....:..|.:.... ||..||..||          .:.....|.:|:.|...|          
 Worm   850 VCCPGRVESPQICQQPMAVGTGGATLPRWYYNAQTMQCVQFNYAGRMGNQNNFQSQQACEQTCPV 914

  Fly    57 ------GGGGLAGSSTGGQSLPDTGGGNSAGGSPAGGSSGTGGGGSNSGISGNNSAMIQGQKSNQ 115
                  .|..:..:|| .:.:|.|.|.||.|.                     :.....|...::
 Worm   915 YVNVCPTGSPMLDAST-NKPVPCTFGSNSCGA---------------------DHWCHLGLVPDE 957

  Fly   116 YEKCAG-PGDPGPCKQY-------------IYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAEC 166
            |:.|.| |.:||.|:..             ..:|.|:.|..:|..|.:.|..|| ||.|.|:.:|
 Worm   958 YQCCPGSPTNPGACQGLPESEGVTGAPAPPTSRWYYDQTDMQCKQFTYNGRRGN-QNNFLTQEDC 1021

  Fly   167 LFHC------IGGPHTLPPFLQSTTREPSTTESSMLLGL----------PYTQSPAQSP------ 209
            ...|      ...|..||..|.|.|....|..::|...:          |....|...|      
 Worm  1022 AATCDVFTNPCNQPIALPATLCSGTGSSDTCGANMWCHIGANQDSTVCCPSEGDPCSLPLARGSG 1086

  Fly   210 ---------------------DGMGGAEGGDGTTPVPIEQRGPELTFAETGQGKTFIFAKNNT 251
                                 .|:.|.:....|.....||.||...|    :|:.|:.|...|
 Worm  1087 NQFMDRFYYNQQTGSCQQFTYSGLHGNQNNFLTQQACEEQCGPNPCF----EGRPFVGADGRT 1145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axoNP_001246631.1 KU 119..171 CDD:238057 20/71 (28%)
Laminin_G_2 275..411 CDD:280389
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:280389
Laminin_G_2 698..817 CDD:280389
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:280389
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:280389
LamG 1612..1733 CDD:304605
Y43F8B.3NP_001256874.1 KU 76..126 CDD:238057
KU 129..182 CDD:238057
Kunitz_BPTI 231..282 CDD:278443
Lustrin_cystein 287..329 CDD:291299
Kunitz_BPTI 335..386 CDD:278443
Lustrin_cystein 393..434 CDD:291299
KU 438..490 CDD:197529
Lustrin_cystein 497..540 CDD:291299
Kunitz_BPTI 545..596 CDD:278443
KU 649..703 CDD:238057
KU 752..804 CDD:238057
Lustrin_cystein 811..853 CDD:291299 1/2 (50%)
Kunitz_BPTI 861..912 CDD:278443 10/50 (20%)
Lustrin_cystein 919..962 CDD:291299 11/64 (17%)
Kunitz_BPTI 981..1025 CDD:278443 13/44 (30%)
Kunitz_BPTI 1076..1128 CDD:278443 7/51 (14%)
Lustrin_cystein 1132..1176 CDD:291299 5/18 (28%)
Kunitz_BPTI 1182..1234 CDD:278443
Lustrin_cystein 1241..1282 CDD:291299
Kunitz_BPTI 1287..1338 CDD:278443
Kunitz_BPTI 1395..1447 CDD:278443
Lustrin_cystein 1453..1492 CDD:291299
Kunitz_BPTI 1499..1549 CDD:278443
KU 1600..1652 CDD:197529
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.