DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment axo and ZC84.6

DIOPT Version :9

Sequence 1:	NP_001246631.1	Gene:	axo / 43923	FlyBaseID:	FBgn0262870	Length:	2179	Species:	Drosophila melanogaster
Sequence 2:	NP_499035.2	Gene:	ZC84.6 / 176299	WormBaseID:	WBGene00013849	Length:	1491	Species:	Caenorhabditis elegans

Alignment Length:	57	Identity:	23/57 - (40%)
Similarity:	31/57 - (54%)	Gaps:	9/57 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   118 KCAGPGDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHC-IGG 173
            |..|||       ..:|:.|.|.|.||.:|.:.||:|| .|.|.:.|||..:| :||
Worm   571 KTCGPG-------VSFKYHYNPQTQECESFEYLGCDGN-SNTFASRAECENYCGVGG 619

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
axo	NP_001246631.1	KU	119..171	CDD:238057	20/52 (38%)
		Laminin_G_2	275..411	CDD:280389
		EGF_CA	433..476	CDD:238011
		Laminin_G_2	514..640	CDD:280389
		Laminin_G_2	698..817	CDD:280389
		EGF_CA	842..878	CDD:238011
		Laminin_G_2	1112..1240	CDD:280389
		EGF_CA	1256..1297	CDD:238011
		Laminin_G_2	1351..1503	CDD:280389
		LamG	1612..1733	CDD:304605
ZC84.6	NP_499035.2	KU	230..286	CDD:197529
		KU	<368..409	CDD:197529
		Kunitz_BPTI	455..507	CDD:278443
		Lustrin_cystein	515..557	CDD:291299
		Kunitz_BPTI	562..616	CDD:278443	20/52 (38%)
		Kunitz_BPTI	671..728	CDD:278443
		Lustrin_cystein	1003..1046	CDD:291299
		EB	1100..1151	CDD:279949
		EB	1162..1213	CDD:279949
		Endonuclease_V	<1390..1409	CDD:294433
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810