powered by:
Protein Alignment axo and Y57A10A.24
DIOPT Version :9
Sequence 1: | NP_001246631.1 |
Gene: | axo / 43923 |
FlyBaseID: | FBgn0262870 |
Length: | 2179 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001370094.1 |
Gene: | Y57A10A.24 / 174864 |
WormBaseID: | WBGene00013264 |
Length: | 520 |
Species: | Caenorhabditis elegans |
Alignment Length: | 138 |
Identity: | 32/138 - (23%) |
Similarity: | 45/138 - (32%) |
Gaps: | 50/138 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 GSSGTGGGGSNSGISGNNSAMIQGQKSNQYEKCAGPGDPG--PCKQYIY-KWRYEPTTNECTNFI 148
|.:||| ||| ||. .|.|..: :...|.|.:.|
Worm 301 GENGTG------------------------EKC----DPAFPACSQGAFCELNKEKTAHIC---- 333
Fly 149 WGGCEGNPQNRFGTEAECLFHCIGGPHTLPPFLQSTT--REPSTTESSMLLGLPYTQSP-AQSPD 210
|: ..:||.|...:.|.. |||..:|| :.|.|..::.....|:...| .|.|:
Worm 334 ---CK-RYKNRLGNSRKTLLP--------PPFYYTTTTMKAPITIATTTAEPYPFESVPNCQDPE 386
Fly 211 GMGGAEGG 218
.....|.|
Worm 387 ARPLMENG 394
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.