DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axo and appb

DIOPT Version :9

Sequence 1:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster
Sequence 2:NP_690842.1 Gene:appb / 170846 ZFINID:ZDB-GENE-020220-1 Length:694 Species:Danio rerio


Alignment Length:251 Identity:43/251 - (17%)
Similarity:78/251 - (31%) Gaps:88/251 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1831 ICCLLEVYRSHLAYKKRIERETDEDIIWS------------KEQATKMHESPGVKAGLLGGVTAG 1883
            :||.:|..:.   .....:.|.:.|:.|.            |||.|...:               
Zfish   187 VCCPMEEQKD---LDSEEQEEANSDVWWGGAETEYTDASVLKEQVTAKPD--------------- 233

  Fly  1884 SGNGLPPYTYKALPQEDKKPGNGAPLVGILKNGSATPSQPGTPTALSKNGDIASRIEEEEEEEDE 1948
                      .|:.::|:...|...  .:..|              .::||.....:||:::||.
Zfish   234 ----------PAVTEDDEDLNNEEE--EVWDN--------------DEDGDGEDDEDEEDDDEDI 272

  Fly  1949 APAQKAAEKSGENEEPPAKDTTASEIKE-----SQAQPPE-------------------QLAKDT 1989
            ...|..:|::..........||...|:|     :.|..|.                   |.||::
Zfish   273 IDEQDTSEQTSNIAMTTTTTTTTESIEEVVRVPTMAPSPADAVDRYLEAPGDMNEHMRFQKAKES 337

  Fly  1990 TDASAAPKAS------KETEAQAE--PSEPSSQLNSAQNGQLAQMEQAARGDEVQV 2037
            .:|....|.|      :|.|.||:  |......:......::..:|:.|.|:..|:
Zfish   338 LEAKHREKMSEVMREWEEAERQAKNLPRADKKTIIQRFQEKVESLEKEAAGERQQL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axoNP_001246631.1 KU 119..171 CDD:238057
Laminin_G_2 275..411 CDD:280389
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:280389
Laminin_G_2 698..817 CDD:280389
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:280389
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:280389
LamG 1612..1733 CDD:304605
appbNP_690842.1 A4_EXTRA 29..190 CDD:128326 1/2 (50%)
APP_N 33..133 CDD:280358
APP_Cu_bd 135..190 CDD:289676 1/2 (50%)
APP_E2 306..488 CDD:289677 17/88 (19%)
Beta-APP 599..637 CDD:281491
APP_amyloid 640..690 CDD:287486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.