powered by:
Protein Alignment axo and CG42828
DIOPT Version :9
Sequence 1: | NP_001246631.1 |
Gene: | axo / 43923 |
FlyBaseID: | FBgn0262870 |
Length: | 2179 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189271.1 |
Gene: | CG42828 / 10178934 |
FlyBaseID: | FBgn0262010 |
Length: | 89 |
Species: | Drosophila melanogaster |
Alignment Length: | 52 |
Identity: | 17/52 - (32%) |
Similarity: | 24/52 - (46%) |
Gaps: | 1/52 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 119 CAGPGDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHC 170
|..|.:.|.|..:...|.:.....||..|::..|.|| :|||.|:..|...|
Fly 28 CYLPYEFGKCGGHRIMWAFSNKEQECVPFVFSNCGGN-ENRFYTKENCEKAC 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.