DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and AT4G33080

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_195034.2 Gene:AT4G33080 / 829445 AraportID:AT4G33080 Length:519 Species:Arabidopsis thaliana


Alignment Length:544 Identity:169/544 - (31%)
Similarity:265/544 - (48%) Gaps:136/544 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKYKPLAMQINQLR 81
            ||:.|...|||::..              |.:..:   |.:..:|::|:...::    |::.:.:
plant    45 ERKERRWILERKLAS--------------SGVPKE---EQINMIKDLERKETEF----MRLKRNK 88

  Fly    82 MNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEERHIMAHANSEW 146
            ::|:||..:.:||.||||||:|.|.:.|..:||||:|.|.||:.|........||:::|...|.:
plant    89 ISVDDFELLTIIGRGAFGEVRLCRERKSGNIYAMKKLKKSEMVMRGQVEHVRAERNLLAEVESHY 153

  Fly   147 IVQLHFAFQDAKYLYMVMDFMPGGDIVS-LMGDYDIPEKWAIFYTMEVVLALDTIHNMGFVHRDV 210
            ||:|:::|||.:|||::|:::||||::: ||.:..:.|..|.||..:.|||:::||...::|||:
plant   154 IVKLYYSFQDPEYLYLIMEYLPGGDMMTLLMREDTLREDVARFYIAQSVLAIESIHRYNYIHRDI 218

  Fly   211 KPDNMLLDSYGHLKLADFGTCMRMGA--------------------------------------- 236
            ||||:|||..||:||:|||.|..:..                                       
plant   219 KPDNLLLDKDGHMKLSDFGLCKPLDCRNLPSIQENRATDDETMSEPMDVDRCFPDTDNKRSWRSP 283

  Fly   237 ---------NGQVVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYAD 292
                     |.:.::.:.|||||||:||||..:|    ||.||||||:|..:||||.|..|||||
plant   284 QEQLQHWQMNRRKLAFSTVGTPDYIAPEVLLKKG----YGMECDWWSLGAIMYEMLVGYPPFYAD 344

  Fly   293 SLVGTYGKIMDHKNSLSFPPEVEISEQAKALIRAFLTDRTQRLGR-YGIEDIKAHPFFRNDTWSF 356
            ..:.|..||:..:|.|.||.:.:.|.:||.||...|.:...|||. .|.:.||.||:|::..|  
plant   345 DPISTCRKIVHWRNHLKFPEDAKFSSEAKDLICRLLCNVDHRLGTGGGAQQIKDHPWFKDVVW-- 407

  Fly   357 DNIRESVPPVVPELSSDDDTRNFEDIERDEKP----------EEVFPVPKGFDGNHLPFIGFTYT 411
            :.:.|......||::.:.||:||...:....|          .::...||     .|.|:|:||.
plant   408 EKLYEMEAAYKPEVNDELDTQNFMKFDEVNSPAPERTRSGLSRKMLLAPK-----DLSFVGYTYK 467

  Fly   412 GDYQLLSSDTVDAESKEANVANSGAASNNHGHGHNHRHRPSNSNELKRLEALLERERGRSEALEQ 476
                  :.|.|                    .|..|      |.|:.|..:|   :|..:||:  
plant   468 ------NFDAV--------------------KGLRH------SLEMARTMSL---DRSPAEAM-- 495

  Fly   477 QDAGLRQQIELITKREAELQRIAS 500
                   .:|||:...||.|.::|
plant   496 -------PVELISGEAAEAQMVSS 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 142/409 (35%)
S_TKc 87..349 CDD:214567 121/311 (39%)
SbcC 484..1088 CDD:223496 7/17 (41%)
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
AT4G33080NP_195034.2 STKc_NDR_like 92..467 CDD:270750 138/385 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.