DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and RPS6KA3

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_011543857.1 Gene:RPS6KA3 / 6197 HGNCID:10432 Length:746 Species:Homo sapiens


Alignment Length:362 Identity:125/362 - (34%)
Similarity:186/362 - (51%) Gaps:39/362 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 FHFIKLIGAGAFGEVQLVRHKSSS---QVYAMKRLSKFEMMKRPDSAFFWEERHIMAHANSEWIV 148
            |..:|::|.|:||:|.||:..|.|   |:||||.|.|..:..| |......||.|:...|..:||
Human    68 FELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVR-DRVRTKMERDILVEVNHPFIV 131

  Fly   149 QLHFAFQDAKYLYMVMDFMPGGDIVS-LMGDYDIPEKWAIFYTMEVVLALDTIHNMGFVHRDVKP 212
            :||:|||....||:::||:.|||:.: |..:....|:...||..|:.||||.:|::|.::||:||
Human   132 KLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKP 196

  Fly   213 DNMLLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGI 277
            :|:|||..||:||.||| ..:...:.:..:.:..||.:|::|||:..:|    :.:..||||.|:
Human   197 ENILLDEEGHIKLTDFG-LSKESIDHEKKAYSFCGTVEYMAPEVVNRRG----HTQSADWWSFGV 256

  Fly   278 FLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEVEISEQAKALIR-AFLTDRTQRL------ 335
            .::|||.|..||.......|...|:  |..|..|.  .:|.:|::|:| .|..:...||      
Human   257 LMFEMLTGTLPFQGKDRKETMTMIL--KAKLGMPQ--FLSPEAQSLLRMLFKRNPANRLVNPFLI 317

  Fly   336 --GRYGIEDIKAHPFFRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERDEKPEEVFPVPKGF 398
              |..|:|:||.|.||....|:....||..||..|.....:||..|:       ||.....||..
Human   318 GAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFD-------PEFTAKTPKDS 375

  Fly   399 DG------NHLPFIGFTY---TGDYQLLSSDTVDAES 426
            .|      .|..|.||::   |.|.:..:..||...|
Human   376 PGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 120/345 (35%)
S_TKc 87..349 CDD:214567 100/274 (36%)
SbcC 484..1088 CDD:223496
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
RPS6KA3XP_011543857.1 S_TKc 68..333 CDD:214567 100/274 (36%)
STKc_RSK_N 72..394 CDD:270734 119/338 (35%)
STKc_RSK2_C 408..737 CDD:271078 2/5 (40%)
Pkinase 428..685 CDD:278497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.