DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and lats1

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001018346.1 Gene:lats1 / 553164 ZFINID:ZDB-GENE-050523-2 Length:1068 Species:Danio rerio


Alignment Length:446 Identity:152/446 - (34%)
Similarity:227/446 - (50%) Gaps:85/446 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETVTKQRSMDVERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKY 70
            |.:.|...   :|.||...||.||:.              ..|..|. .|.:|.:  :.|..:.|
Zfish   588 ENILKNHQ---QRMRRKKQLESEMQR--------------VGLSGDA-QEQMRMM--LSQKESNY 632

  Fly    71 KPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEE 135
                :::.:.:|:...|..||.:|.||||||.|.|...:..:||||.|.|.:::.|...|....|
Zfish   633 ----IRLKRAKMDKCMFEKIKTLGIGAFGEVCLARKVDTGALYAMKTLRKKDVLLRNQVAHVKAE 693

  Fly   136 RHIMAHANSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSL---MGDYDIPEKWAIFYTMEVVLAL 197
            |.|:|.|::||:|:|:::|||...||.|||::||||::||   ||.:.  |..|.||..|::.|:
Zfish   694 RDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFQ--EDLAQFYIAELICAV 756

  Fly   198 DTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTC------------------------------- 231
            :::|.|||:|||:||||:|:|..||:||.|||.|                               
Zfish   757 ESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHVRQDSMDFSMEWED 821

  Fly   232 ---MRMG------------ANGQVVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYE 281
               .|.|            .:.:.::.:.||||:||:||||...|    |.:.|||||||:.|||
Zfish   822 SANCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTG----YTQLCDWWSVGVILYE 882

  Fly   282 MLFGETPFYADSLVGTYGKIMDHKNSLSFPPEVEISEQAKALIRAFLTDRTQRLGRYGIEDIKAH 346
            |:.|:.||.|.:.:.|..|::..:.||..|.:.::|.:|..||.........||||.|.::|||.
Zfish   883 MVVGQPPFLATTPLETQMKVIRWQTSLHIPLQAKLSPEATDLILKLCRGPDDRLGRNGADEIKAQ 947

  Fly   347 PFFRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERDEKPEEVFPVPKGFDGNH 402
            ||||....|.|..::...|.:|:::...||.||:.::.|:...|      ..||||
Zfish   948 PFFRTIDLSKDLRQQHQAPYIPKITHSTDTSNFDPVDPDKLWSE------DADGNH 997

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 139/391 (36%)
S_TKc 87..349 CDD:214567 119/310 (38%)
SbcC 484..1088 CDD:223496
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
lats1NP_001018346.1 PKc_like 644..1024 CDD:304357 136/366 (37%)
S_TKc 645..950 CDD:214567 119/310 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.