DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and Stk38

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_006256201.2 Gene:Stk38 / 361813 RGDID:1309455 Length:465 Species:Rattus norvegicus


Alignment Length:453 Identity:168/453 - (37%)
Similarity:247/453 - (54%) Gaps:73/453 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RETVTKQRSMDVERRRRANTLEREMRDP--TSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYA 67
            |.|:||....:......|...|||||..  ..:...:.|.|         :.:.|||..:     
  Rat    19 RVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKD---------EEKRLRRSAH----- 69

  Fly    68 AKYKPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFF 132
            |:.:...:::.:.|:.:|||..:|:||.||||||:||:.|.:..|||||.|.|.:|:::......
  Rat    70 ARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHI 134

  Fly   133 WEERHIMAHANSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYD-IPEKWAIFYTMEVVLA 196
            ..||.|:..|:|.|:|::.::|||...||::|:|:||||:::|:...| :.|:...||..|.|||
  Rat   135 RAERDILVEADSLWVVRMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLA 199

  Fly   197 LDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTC-------------------------MRMGA 236
            :|:||.:||:|||:||||:||||.||:||:|||.|                         ..|.:
  Rat   200 IDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNS 264

  Fly   237 ---------NGQVVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYAD 292
                     |.:.::.:.|||||||:|||....|    |.:.|||||:|:.:||||.|..||.::
  Rat   265 KRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTG----YNKLCDWWSLGVIMYEMLIGYPPFCSE 325

  Fly   293 SLVGTYGKIMDHKNSLSFPPEVEISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFD 357
            :...||.|:|:.|.:|:|||||.:||:||.||..|..:...|:|..|:|:||::|||....|  :
  Rat   326 TPQETYKKVMNWKETLTFPPEVPVSEKAKGLILRFCCEWEHRIGAPGVEEIKSNPFFEGVDW--E 388

  Fly   358 NIRESVPPVVPELSSDDDTRNFEDIERDEKPEEVFPVPKGFDGNHLP----------FIGFTY 410
            :|||....:..|:.|.|||.||     ||.||.....|.....|| |          ||.:||
  Rat   389 HIRERPAAISIEIKSIDDTSNF-----DEFPESDILKPTVTTSNH-PETDYKSKDWVFINYTY 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 153/395 (39%)
S_TKc 87..349 CDD:214567 124/296 (42%)
SbcC 484..1088 CDD:223496
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
Stk38XP_006256201.2 STKc_NDR1 87..462 CDD:270777 151/371 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.