DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and Lats1

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001128015.2 Gene:Lats1 / 308265 RGDID:1564085 Length:1130 Species:Rattus norvegicus


Alignment Length:510 Identity:159/510 - (31%)
Similarity:254/510 - (49%) Gaps:108/510 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETVTKQRSMDVERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKY 70
            |.|.|.....:.|:::   ||.||               :...:|....:.:|::  :.|..:.|
  Rat   648 ENVLKSHQQRLHRKKQ---LENEM---------------MRVGLSQDAQDQMRKM--LCQKESNY 692

  Fly    71 KPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEE 135
                :::.:.:|:...|..||.:|.||||||.|.|...:..:||.|.|.|.:::.|...|....|
  Rat   693 ----IRLKRAKMDKSMFVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAE 753

  Fly   136 RHIMAHANSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSL---MGDYDIPEKWAIFYTMEVVLAL 197
            |.|:|.|::||:|:|:::|||...||.|||::||||::||   ||.:  ||..|.||..|:..|:
  Rat   754 RDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIF--PENLARFYIAELTCAV 816

  Fly   198 DTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTC------------------------------- 231
            :::|.|||:|||:||||:|:|..||:||.|||.|                               
  Rat   817 ESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSSEWGD 881

  Fly   232 ---MRMG------------ANGQVVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYE 281
               .|.|            .:.:.::.:.||||:||:||||...|    |.:.|||||||:.|:|
  Rat   882 PSNCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTG----YTQLCDWWSVGVILFE 942

  Fly   282 MLFGETPFYADSLVGTYGKIMDHKNSLSFPPEVEISEQAKALIRAFLTDRTQRLGRYGIEDIKAH 346
            ||.|:.||.|.:.:.|..|:::.:.||..||:.::|.:|..||.........|||:.|.::||||
  Rat   943 MLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAH 1007

  Fly   347 PFFRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERD-----------------------EKP 388
            |||:...:|.| :|:.....:|:::...||.||:.::.|                       :.|
  Rat  1008 PFFKTIDFSSD-LRQQSASYIPKITHPTDTSNFDPVDPDKLWSDGNEEENINDTLNGWYKNGKHP 1071

  Fly   389 EEV---FPVPKGFDGNHLPFIGFTYTGDYQLLSSDTVDAESKEANVANSGAASNN 440
            |..   |...:.||.|..|: .:....:|:.:||...:.:|.|.: .::|:..||
  Rat  1072 EHAFYEFTFRRFFDDNGYPY-NYPKPIEYEYVSSQGSEQQSDEDD-QHTGSDVNN 1124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 141/424 (33%)
S_TKc 87..349 CDD:214567 120/310 (39%)
SbcC 484..1088 CDD:223496
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
Lats1NP_001128015.2 UBA_like_SF 103..143 CDD:419673
PHA03247 <183..590 CDD:223021
STKc_LATS1 703..1084 CDD:270775 134/387 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.