DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and Lats2

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001100737.1 Gene:Lats2 / 305922 RGDID:1305906 Length:1042 Species:Rattus norvegicus


Alignment Length:504 Identity:165/504 - (32%)
Similarity:244/504 - (48%) Gaps:111/504 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETVTKQRSMDVERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKY 70
            |.|.|.....|.||.:   ||:||               ..|.:.:.:.|.:|::  :.|..:.|
  Rat   569 ENVIKTYQQKVSRRLQ---LEQEM---------------AKAGLCETEQEQMRKI--LYQKESNY 613

  Fly    71 KPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEE 135
            .    ::.:.:|:...|..||.:|.||||||.|.....:..:||||.|.|.:::.|...|....|
  Rat   614 N----RLKRAKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDVLNRNQVAHVKAE 674

  Fly   136 RHIMAHANSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYDI-PEKWAIFYTMEVVLALDT 199
            |.|:|.|::||:|:|:::|||...||.|||::||||::||:...:: ||..|.||..|:.||:::
  Rat   675 RDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIES 739

  Fly   200 IHNMGFVHRDVKPDNMLLDSYGHLKLADFGTC--------------------------------- 231
            :|.|||:|||:||||:|:|..||:||.|||.|                                 
  Rat   740 VHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGNHIRQDSMEPGDLWDDVS 804

  Fly   232 -MRMGANGQVVSSNA------------VGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEML 283
             .|.|...:.:...|            ||||:||:||||..:|    |.:.|||||||:.|:|||
  Rat   805 NCRCGDRLKTLEQRAQKQHQRCLAHSLVGTPNYIAPEVLLRKG----YTQLCDWWSVGVILFEML 865

  Fly   284 FGETPFYADSLVGTYGKIMDHKNSLSFPPEVEISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPF 348
            .|:.||.|.:...|..|:::.:|:|..|.:|::|.:|:.||.........||||.|.:|:|||||
  Rat   866 VGQPPFLAPTPTETQLKVINWENTLHIPTQVKLSAEARDLITKLCCAADCRLGRDGADDLKAHPF 930

  Fly   349 FRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERD----------------------EKPEEV 391
            |....:|.| ||:...|.||.:|...||.||:.::.:                      :.||..
  Rat   931 FSTIDFSRD-IRKQPAPYVPTISHPMDTSNFDPVDEESPWHEASGESAKAWDTLASPNSKHPEHA 994

  Fly   392 ---FPVPKGFDGNHLPFIGFTYTGDYQLLSSDTVDAESKEANVANSGAA 437
               |...:.||.|..||          .....:..|||.:...|..|.|
  Rat   995 FYEFTFRRFFDDNGYPF----------RCPKPSEPAESADPGDAELGGA 1033

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 146/421 (35%)
S_TKc 87..349 CDD:214567 121/308 (39%)
SbcC 484..1088 CDD:223496
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
Lats2NP_001100737.1 UBA_LATS2 101..141 CDD:270581
PHA03247 <143..490 CDD:223021
PKc_like 624..1004 CDD:419665 138/384 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.