DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and LATS2

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_055387.2 Gene:LATS2 / 26524 HGNCID:6515 Length:1088 Species:Homo sapiens


Alignment Length:497 Identity:165/497 - (33%)
Similarity:243/497 - (48%) Gaps:108/497 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETVTKQRSMDVERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKY 70
            |.|.|.....|.||.:   ||:||               ..|.:.:.:.|.:|::  :.|..:.|
Human   611 ENVIKTYQQKVNRRLQ---LEQEM---------------AKAGLCEAEQEQMRKI--LYQKESNY 655

  Fly    71 KPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEE 135
            .    ::.:.:|:...|..||.:|.||||||.|.....:..:||||.|.|.:::.|...|....|
Human   656 N----RLKRAKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDVLNRNQVAHVKAE 716

  Fly   136 RHIMAHANSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYDI-PEKWAIFYTMEVVLALDT 199
            |.|:|.|::||:|:|:::|||...||.|||::||||::||:...:: ||..|.||..|:.||:::
Human   717 RDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIES 781

  Fly   200 IHNMGFVHRDVKPDNMLLDSYGHLKLADFGTC--------------------------------- 231
            :|.|||:|||:||||:|:|..||:||.|||.|                                 
Human   782 VHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSDLWDDVS 846

  Fly   232 -MRMGANGQVVSSNA------------VGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEML 283
             .|.|...:.:...|            ||||:||:||||..:|    |.:.|||||||:.|:|||
Human   847 NCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLLRKG----YTQLCDWWSVGVILFEML 907

  Fly   284 FGETPFYADSLVGTYGKIMDHKNSLSFPPEVEISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPF 348
            .|:.||.|.:...|..|:::.:|:|..|.:|::|.:|:.||.........||||.|.:|:|||||
Human   908 VGQPPFLAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITKLCCSADHRLGRNGADDLKAHPF 972

  Fly   349 FRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERD----------------------EKPEEV 391
            |....:|.| ||:...|.||.:|...||.||:.::.:                      :.||..
Human   973 FSAIDFSSD-IRKQPAPYVPTISHPMDTSNFDPVDEESPWNDASEGSTKAWDTLTSPNNKHPEHA 1036

  Fly   392 ---FPVPKGFDGNHLPF-------IGFTYTGDYQLLSSDTVD 423
               |...:.||.|..||       ...:......|.|||.||
Human  1037 FYEFTFRRFFDDNGYPFRCPKPSGAEASQAESSDLESSDLVD 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 146/428 (34%)
S_TKc 87..349 CDD:214567 121/308 (39%)
SbcC 484..1088 CDD:223496
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
LATS2NP_055387.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..49
UBA_LATS2 101..141 CDD:270581
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..323
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..428
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..483
PPxY motif 515..518
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..592
STKc_LATS2 666..1046 CDD:173715 138/384 (36%)
S_TKc 668..973 CDD:214567 121/308 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 994..1022 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1056..1088 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.