DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and Stk38l

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_006507092.1 Gene:Stk38l / 232533 MGIID:1922250 Length:477 Species:Mus musculus


Alignment Length:438 Identity:165/438 - (37%)
Similarity:242/438 - (55%) Gaps:72/438 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKYKPLAMQINQLR 81
            ||..|...||..|.:       :.|.|         :.:.|||    .|:|.|.... :::.:.|
Mouse    47 ERETRQKKLEVAMEE-------EGLAD---------EEKKLRR----SQHARKETEF-LRLKRTR 90

  Fly    82 MNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEERHIMAHANSEW 146
            :.::||..:|:||.||||||:||:.|.:..:||||.|.|.:|:::...|....||.|:..|:..|
Mouse    91 LGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAW 155

  Fly   147 IVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYD-IPEKWAIFYTMEVVLALDTIHNMGFVHRDV 210
            :|::.::|||.:.||::|:|:||||:::|:...| :.|:...||..|.|||:|.||.:||:||||
Mouse   156 VVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDV 220

  Fly   211 KPDNMLLDSYGHLKLADFGTC-------------------------MRMGA---------NGQVV 241
            ||||:|||:.||:||:|||.|                         ..|.:         |.:.:
Mouse   221 KPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQL 285

  Fly   242 SSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKN 306
            :.:.|||||||:|||....|    |.:.|||||:|:.:||||.|..||.:::...||.|:|..|.
Mouse   286 AYSTVGTPDYIAPEVFMQTG----YNKLCDWWSLGVIMYEMLIGFPPFCSETPQETYRKVMSWKE 346

  Fly   307 SLSFPPEVEISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRESVPPVVP-EL 370
            :|:|||||.:||:||.||..|.||...|:|..|:|:||.||||....|.  :|||. |..:| |:
Mouse   347 TLAFPPEVPVSEKAKDLILRFCTDSENRIGNGGVEEIKGHPFFEGVDWG--HIRER-PAAIPIEI 408

  Fly   371 SSDDDTRNFEDIERDEKPEEV----FPVPK----GFDGNHLPFIGFTY 410
            .|.|||.||:|....:..:.|    |.||.    .:......|:.:||
Mouse   409 RSIDDTSNFDDFPESDILQPVAFFLFLVPNTTEPDYKSKDWVFLNYTY 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 154/394 (39%)
S_TKc 87..349 CDD:214567 126/296 (43%)
SbcC 484..1088 CDD:223496
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
Stk38lXP_006507092.1 STKc_NDR2 93..465 CDD:270776 150/371 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.