DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and DMPK

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001275693.1 Gene:DMPK / 1760 HGNCID:2933 Length:655 Species:Homo sapiens


Alignment Length:511 Identity:190/511 - (37%)
Similarity:294/511 - (57%) Gaps:44/511 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AKYKPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFF 132
            ::.:|:.:::.::|:..:||..:|:||.|||.||.:|:.|.:.||||||.::|::|:||.:.:.|
Human    78 SRAEPIVVRLKEVRLQRDDFEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCF 142

  Fly   133 WEERHIMAHANSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYD--IPEKWAIFYTMEVVL 195
            .|||.::.:.:..||.||||||||..|||:||::..|||:::|:..:.  ||.:.|.||..|:|:
Human   143 REERDVLVNGDRRWITQLHFAFQDENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIVM 207

  Fly   196 ALDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISPEVLQSQ 260
            |:|::|.:|:||||:||||:|||..||::|||||:|:::.|:|.|.|..|||||||:|||:||:.
Human   208 AIDSVHRLGYVHRDIKPDNILLDRCGHIRLADFGSCLKLRADGTVRSLVAVGTPDYLSPEILQAV 272

  Fly   261 G---VDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEVE-ISEQAK 321
            |   ....||.|||||::|:|.|||.:|:|||||||...|||||:.:|..||.|...| :.|:|:
Human   273 GGGPGTGSYGPECDWWALGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLSLPLVDEGVPEEAR 337

  Fly   322 ALIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIER-- 384
            ..|:..|.....||||.|..|.:.||||....|  |.:|:||||..|:.....||.||:.:|.  
Human   338 DFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDW--DGLRDSVPPFTPDFEGATDTCNFDLVEDGL 400

  Fly   385 ----DEKPEEVFPVPKGFD-GNHLPFIGFTYT----GDYQLLSSDTVDAESKEANVANSGAASNN 440
                ....|.:..:.:|.. |.||||:|::|:    .|.::.....::.|:::....:..|.|  
Human   401 TAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTPMELEAEQLLEPHVQAPS-- 463

  Fly   441 HGHGHNHRHRPSNSNELKRLEALLERERGRSEALEQQDAGLRQQIELITKREAELQRIASEYEKD 505
                    ..||.|.:.:..|..:......:||  :.:..||:..|.:.:.....|.::.|.|  
Human   464 --------LEPSVSPQDETAEVAVPAAVPAAEA--EAEVTLRELQEALEEEVLTRQSLSREME-- 516

  Fly   506 LALRQHNYKVAMQKVEQEI----------ELRKKTEALLVETQRNLENEQKTRARD 551
             |:|..|...|.|..|.|.          :|:::.|.|..|....:......||.|
Human   517 -AIRTDNQNFASQLREAEARNRDLEAHVRQLQERMELLQAEGATAVTGVPSPRATD 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 159/355 (45%)
S_TKc 87..349 CDD:214567 133/267 (50%)
SbcC 484..1088 CDD:223496 18/78 (23%)
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
DMPKNP_001275693.1 STKc_DMPK_like 95..432 CDD:270748 157/338 (46%)
S_TKc 97..365 CDD:214567 133/267 (50%)
DMPK_coil 496..556 CDD:117396 14/62 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.