DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and TACC3

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_005247986.1 Gene:TACC3 / 10460 HGNCID:11524 Length:842 Species:Homo sapiens


Alignment Length:607 Identity:123/607 - (20%)
Similarity:200/607 - (32%) Gaps:221/607 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 PPV---------VPELSSDDDTRNFEDIERDEKPEEVFPVP-----------KGFDGNHLPFIGF 408
            ||:         .|:...:||.|:    ...|.|    |:|           |..|.|.:||.|.
Human   365 PPLRKAAVRQQKAPQEVEEDDGRS----GAGEDP----PMPASRGSYHLDWDKMDDPNFIPFGGD 421

  Fly   409 TYTGDYQLLSSDTVDAESKE-------ANVANSGAASNNHG-------HGHNHRHRP-------- 451
            |.:|     .|:....||.|       |...::|.|:...|       |..:....|        
Human   422 TKSG-----CSEAQPPESPETRLGQPAAEQLHAGPATEEPGPCLSQQLHSASAEDTPVVQLAAET 481

  Fly   452 ----SNSNELKRLEALLERERGRSE----------ALEQQDAGLRQQIELI-TKREAE-LQRIAS 500
                |....|......|......||          |||.::...|...|:: |..|.: |::..:
Human   482 PTAESKERALNSASTSLPTSCPGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGT 546

  Fly   501 EYEKDLALRQHNYKVAMQKVEQEIELRKKTEALLVETQRNLENEQKTRARDLNINDKVVSLEKQL 565
            ...|:.|||:.:..:....:.::...|....|....:..........|.|           |.:|
Human   547 SSFKESALRKQSLYLKFDPLLRDSPGRPVPVATETSSMHGANETPSGRPR-----------EAKL 600

  Fly   566 LEMEQSYKTETENTQKLKKHNAELDFTVKSQEEKV----------RDMVDMIDTLQKHKEELGQE 620
            :|.:               ....||..|......|          ..:||::...||        
Human   601 VEFD---------------FLGALDIPVPGPPPGVPAPGGPPLSTGPIVDLLQYSQK-------- 642

  Fly   621 NAELQALVVQEKNLRSQLKEMHKEAENKMQTLINDIERTMCREQKAQEDNRALLEKISDLEKAHA 685
              :|.|:|      |:|:|                         ..||:||.|..:..:|.    
Human   643 --DLDAVV------RTQVK-------------------------ATQEENRELRSRCEELH---- 670

  Fly   686 GLDFELKAAQGRYQQEV-KAHQETEKSRLVSREEANLQEVKALQSKLNEEKSARIKADQHSQEK- 748
            |.:.||.....|:::.| :|.:|.:|.:.:|:.|        :|..|.|:.  ::..|.:|.|| 
Human   671 GKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAE--------IQKVLKEKD--QLTTDLNSMEKS 725

  Fly   749 --------ERQLSMLSVDYRQIQLRLQKLE----GECRQESEKVAALQSQLDQEHSKRNALLSEL 801
                    |:|..::. .||:.:..|:|..    ....||.::..||::..::          :|
Human   726 FSDLFKRFEKQKEVIE-GYRKNEESLKKCVEDYLARITQEGQRYQALKAHAEE----------KL 779

  Fly   802 SLHSSEVAHLRSRENQLQKELSTQREAKRRFEEDLTQLKSTHHEALANNRELQAQLEAEQC-FSR 865
            .|.:.|:|.:||:                           ...||||    |||.|..||. ...
Human   780 QLANEEIAQVRSK---------------------------AQAEALA----LQASLRKEQMRIQS 813

  Fly   866 LYKTQANENREESAERLSKIED 887
            |.||...:.:|.  |.|::|.|
Human   814 LEKTVEQKTKEN--EELTRICD 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 17/66 (26%)
S_TKc 87..349 CDD:214567
SbcC 484..1088 CDD:223496 86/431 (20%)
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
TACC3XP_005247986.1 TACC 639..836 CDD:282818 65/294 (22%)
iSH2_PI3K_IA_R 656..>757 CDD:304922 29/115 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.