DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and LOC100535131

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_017210028.2 Gene:LOC100535131 / 100535131 -ID:- Length:188 Species:Danio rerio


Alignment Length:184 Identity:129/184 - (70%)
Similarity:154/184 - (83%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 VQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYDIPEKWAIFYTMEVVLALDTIHNMGFVHRDVKP 212
            :||..||||.||||:||:||||||:|:|..:|||||:||.|||.|||||||.||::||:|||:||
Zfish     5 LQLCCAFQDEKYLYLVMEFMPGGDLVTLTSNYDIPEEWAQFYTAEVVLALDAIHSLGFIHRDIKP 69

  Fly   213 DNMLLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISPEVLQSQGVDNEYGRECDWWSVGI 277
            ||||||..||.||||||||.:|.:.|.|....|||||||||||||.|||....|||||||||||:
Zfish    70 DNMLLDRNGHFKLADFGTCTKMDSTGMVSCDAAVGTPDYISPEVLMSQGGTGYYGRECDWWSVGV 134

  Fly   278 FLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEVEISEQAKALIRAFLTDR 331
            |:||:|.|:||||::||||||||||||||||:||.::|:|:.||.||.|||:.|
Zfish   135 FIYELLVGDTPFYSESLVGTYGKIMDHKNSLTFPDDIEMSKDAKDLICAFLSSR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 129/184 (70%)
S_TKc 87..349 CDD:214567 129/184 (70%)
SbcC 484..1088 CDD:223496
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
LOC100535131XP_017210028.2 PKc_like <5..>188 CDD:328722 128/182 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D36370at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.