DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rok and lats2

DIOPT Version :9

Sequence 1:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_012811721.1 Gene:lats2 / 100124721 XenbaseID:XB-GENE-994907 Length:1117 Species:Xenopus tropicalis


Alignment Length:529 Identity:166/529 - (31%)
Similarity:250/529 - (47%) Gaps:118/529 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETVTKQRSMDVERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKY 70
            |.|.|.....:.||.:   ||:||.: ..:|              :...|.:|::  :.|..:.|
 Frog   641 ENVLKTYQQKINRRLQ---LEQEMAE-AGLC--------------EAIQEQMRKI--LYQKESNY 685

  Fly    71 KPLAMQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWEE 135
            .    ::.:.:|:...|..||.:|.||||||.|.....:..:||||.|.|.:::.|...|....|
 Frog   686 N----RLKRAKMDKSLFVKIKTLGIGAFGEVCLASKVDTKALYAMKTLRKKDVLNRNQVAHVKAE 746

  Fly   136 RHIMAHANSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYDI-PEKWAIFYTMEVVLALDT 199
            |.|:|.|::||:|:|:::|||...||.|||::||||::||:...:: ||..|.||..|:.||:::
 Frog   747 RDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIES 811

  Fly   200 IHNMGFVHRDVKPDNMLLDSYGHLKLADFGTC--------------------------------- 231
            :|.|||:|||:||||:|:|..||:||.|||.|                                 
 Frog   812 VHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGNHARQDSMEPSELWDDVS 876

  Fly   232 -MRMGANGQVVSSNA------------VGTPDYISPEVLQSQGVDNEYGRECDWWSVGIFLYEML 283
             .|.|...:.:...|            ||||:||:||||..:|    |.:.|||||||:.|:|||
 Frog   877 NCRCGDRLKTLEQRAKRQHHRCLAHSLVGTPNYIAPEVLLRKG----YTQLCDWWSVGVILFEML 937

  Fly   284 FGETPFYADSLVGTYGKIMDHKNSLSFPPEVEISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPF 348
            .|:.||.|.:...|..|::..:|:|..|.::.:|.:|..||.|.......||||.|.::||||||
 Frog   938 VGQPPFLASNPTETQLKVIHWENTLHIPSQINLSPEATNLITALCCGAEDRLGRNGPDEIKAHPF 1002

  Fly   349 FRNDTWSFDNIRESVPPVVPELSSDDDTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTYTGD 413
            |.:..:|.| ||....|.||::|...||.||:.:| :|.|                         
 Frog  1003 FISMDFSSD-IRHQPAPYVPKISHPMDTSNFDPVE-EENP------------------------- 1040

  Fly   414 YQLLSSDTVDAESKEANVANSGAASNNHG------------HGHNHRHRPSNSNELKRLEALLER 466
                .:|:.|:......:.:||.....|.            ||:..|:...:..|....|...|.
 Frog  1041 ----CNDSGDSTVTWDTLMSSGNKHTEHAFYEFTFRRFFDDHGYPFRYPKPSKLETSSCEETEEE 1101

  Fly   467 ERGRSEALE 475
            ::..|...|
 Frog  1102 DKNASRESE 1110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747 141/396 (36%)
S_TKc 87..349 CDD:214567 121/308 (39%)
SbcC 484..1088 CDD:223496
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
lats2XP_012811721.1 UBA_LATS2 102..142 CDD:270581
PKc_like 696..1075 CDD:419665 143/413 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.