DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and RPT1

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_012777.1 Gene:RPT1 / 853712 SGDID:S000001628 Length:467 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:28/142 - (19%)
Similarity:53/142 - (37%) Gaps:38/142 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RAGTDE----IVCFHQIEVESIFQKEGWCEQDPMAIVNTVNECITGACKKLVAVGGKVEEIIT-- 94
            :||..|    :...|..::....|:.|  |:.|:.:..         |.|::...|:.:|..|  
Yeast    66 KAGVKESDTGLAPSHLWDIMGDRQRLG--EEHPLQVAR---------CTKIIKGNGESDETTTDN 119

  Fly    95 ------IGITNQRESTVVWDRNSGQPLVNA------IIWLDNRTTST-VEELLET-IPNNARNIN 145
                  ...:||:.:....|....:.::|.      ::.|..|.:.| :||.:.. :..:..||.
Yeast   120 NNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIE 184

  Fly   146 YLRPLCGLPLSP 157
                   |||.|
Yeast   185 -------LPLPP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 28/142 (20%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 28/142 (20%)
RPT1NP_012777.1 RPT1 28..464 CDD:224143 28/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.