DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and YTA7

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_011786.1 Gene:YTA7 / 853186 SGDID:S000003502 Length:1379 Species:Saccharomyces cerevisiae


Alignment Length:135 Identity:33/135 - (24%)
Similarity:55/135 - (40%) Gaps:26/135 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SIFQKEGWCEQDPMAIVNTVNECITGACKKLVAV--GGKVEEIITIGITNQRESTVVWD---RNS 111
            ::::||     .|.||.:.|::      :|.|..  .|..||..|..|.....|.:..|   |..
Yeast  1194 NLYKKE-----IPAAIPSAVDK------EKAVIPEDSGANEEYTTELIQATCTSEITTDDDERAR 1247

  Fly   112 GQPLVNAIIWLDNRTTSTVEELLETIPNNARNINYLRPLCGL--PLSPYFSGVKLRWLRDNVPVV 174
            .:|..|.    |:..|...||....|..|..|||:::.:..:  |.|.:.:..|    |:..|:.
Yeast  1248 KEPKENE----DSLQTQVTEENFSKIDANTNNINHVKEIQSVNKPNSLHETVEK----RERSPIP 1304

  Fly   175 SQAME 179
            .:.:|
Yeast  1305 KEVVE 1309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 33/135 (24%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 33/135 (24%)
YTA7NP_011786.1 RecA-like_Yta7-like 414..583 CDD:410925
SpoVK 430..>882 CDD:223540
Bromo_TBP7_like 979..1098 CDD:99923
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.