DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and KATNAL2

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001340828.1 Gene:KATNAL2 / 83473 HGNCID:25387 Length:564 Species:Homo sapiens


Alignment Length:290 Identity:62/290 - (21%)
Similarity:100/290 - (34%) Gaps:94/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SRTMLMNIETLQWDANLLKFFGL--PKTILPEICSSSEFYGSIAQGVL---QGIGITSVLGDQQA 272
            ||.:.::...::|:    ...||  .|.::.|.......|..:..|:|   :|:.:....|    
Human   267 SRDIYLHNPNIKWN----DIIGLDAAKQLVKEAVVYPIRYPQLFTGILSPWKGLLLYGPPG---- 323

  Fly   273 ALVGQQCLAKG---QAKATYGTGCFLLYNTGPS-IVHSTHG---LLTTVGYQLGRKAVP----FY 326
              .|:..|||.   :.|.|:       :|...| ||....|   .|..|.::|.|...|    ..
Human   324 --TGKTLLAKAVATECKTTF-------FNISASTIVSKWRGDSEKLVRVLFELARYHAPSTIFLD 379

  Fly   327 ALEGSVSIAGAAFNW-----LRDNMNLIQNSGQIETMASTVDNSLDVYFVPAFNGLYAPYW---- 382
            .||..:|..|.|...     ||....|:.   |::.:|    .|.|:.||.|.:.|  | |    
Human   380 ELESVMSQRGTASGGEHEGSLRMKTELLV---QMDGLA----RSEDLVFVLAASNL--P-WELDC 434

  Fly   383 ---------------NQDARGVI----------------------CGLSEET---TSEHIVRATL 407
                           :::||..:                      ..||:||   :...|.....
Human   435 AMLRRLEKRILVDLPSREARQAMIYHWLPPVSKSRALELHTELEYSVLSQETEGYSGSDIKLVCR 499

  Fly   408 EAVCFQVRDILDSM--HKDCKIPLAKLMVD 435
            ||....||.|.|::  |:.....|.::.:|
Human   500 EAAMRPVRKIFDALENHQSESSDLPRIQLD 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 62/290 (21%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 62/290 (21%)
KATNAL2NP_001340828.1 LisH 51..81 CDD:128913
SpoVK <264..559 CDD:223540 62/290 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.