DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and Psmc5

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_112411.1 Gene:Psmc5 / 81827 RGDID:708376 Length:406 Species:Rattus norvegicus


Alignment Length:464 Identity:88/464 - (18%)
Similarity:152/464 - (32%) Gaps:161/464 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 STVEELLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVPV----------VSQAMEKGT 182
            |.:|||...:.:.::|:..|:      ........|:|.||:.:.:          |.:||:|..
  Rat    26 SKIEELQLIVNDKSQNLRRLQ------AQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKK 84

  Fly   183 AMFG-------TIDTWLMYNLTGGKDCGVHKTDVTNASRTMLMNIETLQWDANLLKFFGLPKTIL 240
            .:..       .:|.          |..:...|||...|..|.|      |:..|... ||..:.
  Rat    85 VLVKVHPEGKFVVDV----------DKNIDINDVTPNCRVALRN------DSYTLHKI-LPNKVD 132

  Fly   241 PEIC---------SSSEFYGSIAQGV----------------LQGIGITSVLGDQQAALV----- 275
            |.:.         |:.|..|.:.:.:                .:.:||....|    .|:     
  Rat   133 PLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKG----VLLYGPPG 193

  Fly   276 -GQQCLAKGQAKATYGTGCFLLYNTGPSIVHSTHGLLTTVGYQLGRKAVPFYALEGSVSIAGAAF 339
             |:..||:..|   :.|.|..:..:|..:|....|    .|.::.|:.. ..|.|.:.||.    
  Rat   194 TGKTLLARAVA---HHTDCTFIRVSGSELVQKFIG----EGARMVRELF-VMAREHAPSII---- 246

  Fly   340 NWLRDNMNLIQNS-------GQIETMASTVD--NSLDVYFVPAFNGLYAPYWNQDARGVICGLSE 395
              ..|.::.|.:|       |..|...:.::  |.||.:                         |
  Rat   247 --FMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGF-------------------------E 284

  Fly   396 ETTSEHIVRATLEAVCFQVRDILDSM-----HKDCKIPLAKLMVDGGMTVNNLFLQLQSDLVGIQ 455
            .|.:..::.||...      |||||.     ..|.||.......:..:.:..:..:..:...||.
  Rat   285 ATKNIKVIMATNRI------DILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGIN 343

  Fly   456 VLRAKIAETTALGAAMAAYKAV----------ENRYQM-----EAPLSKSGPREAIKPSISATDR 505
            :  .||||... ||:.|..|.|          |.|..:     |..::|...::        :::
  Rat   344 L--RKIAELMP-GASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKD--------SEK 397

  Fly   506 NLRYQK-WK 513
            |:..:| ||
  Rat   398 NMSIKKLWK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 88/464 (19%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 88/464 (19%)
Psmc5NP_112411.1 RPT1 4..404 CDD:224143 85/460 (18%)
May mediate interaction with PRPF9. /evidence=ECO:0000250|UniProtKB:P62196 186..406 53/275 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.