DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and PSMC5

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_024306608.1 Gene:PSMC5 / 5705 HGNCID:9552 Length:433 Species:Homo sapiens


Alignment Length:135 Identity:27/135 - (20%)
Similarity:52/135 - (38%) Gaps:23/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 NQDARGVICGLSEETTSEHIVRATLEAVCFQ---VRDILDSMHKDCKIPLAKLMVDGGMTVNNLF 444
            :|:.|.:....:|......::|..|:.:..|   |.:::.:|.|  |..|.|:..:|...|:   
Human    39 SQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDK--KKVLVKVHPEGKFVVD--- 98

  Fly   445 LQLQSDLVGIQVLRAKIAETTALGAAMAAYKAVENRYQMEAPLSKSGPREAIKPSISATDRNLRY 509
            :....|:..:.|....:   ..:|:|:.            .||.|..|...:.|:.....||..|
Human    99 VDKNIDINDVSVAGEVV---VVVGSALT------------VPLLKLAPFTQVTPNCRVALRNDSY 148

  Fly   510 QKWKM 514
            ...|:
Human   149 TLHKI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 27/135 (20%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 27/135 (20%)
PSMC5XP_024306608.1 RPT1 4..431 CDD:224143 27/135 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.