DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk1 and Kat60

DIOPT Version :9

Sequence 1:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster


Alignment Length:179 Identity:41/179 - (22%)
Similarity:62/179 - (34%) Gaps:60/179 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 WLDNRTTSTVEELLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVPVVSQAMEKGTAMF 185
            |.|.......:.|||    .|..:..|.|       .||.|::..|             ||..|.
  Fly   325 WSDIADLHDAKRLLE----EAVVLPMLMP-------DYFKGIRRPW-------------KGVLMV 365

  Fly   186 GTIDTWLMYNLTGGK---------DCGVHKTDVTNASRTMLMNIETLQWDANLLKF--FGLPKTI 239
            |...|        ||         :||....:|::|:.|.....|:.:....|.:.  |..|.||
  Fly   366 GPPGT--------GKTMLAKAVATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPSTI 422

  Fly   240 ----LPEICS--SSEFYGSIAQGV-------LQGIGITSVLGDQQAALV 275
                :..:||  .||.....::.|       :.|:|    .|::||.:|
  Fly   423 FIDEIDSLCSRRGSESEHEASRRVKSELLVQMDGVG----GGEEQAKVV 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 41/179 (23%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 41/179 (23%)
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 19/87 (22%)
AAA 358..496 CDD:214640 30/135 (22%)
AAA 362..495 CDD:278434 27/118 (23%)
Vps4_C <570..603 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.